KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1554Help
Entry
uc509_1554        CDS       T02415                                 

Gene name
proB
Definition
Glutamate 5-kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lli01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:lli00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1540730..1541542)
Genome map
AA seq 270 aa AA seqDB search
MIITRKNILKAQRIVVKIGTSSLILPNGKINLSNIDELAFVLSDLNNKGYEVILVTSGAI
GVGLNVLGMDKRPKGIADQQALASIGQVELMSLYTQMFRRYSQKVSQLLLTRDVTDFPTS
RENAENALNALLALDIIPIINENDAIAVDEMDHQTKFGDNDKLGAIVSKLVHADLLIMLS
DIDGLFDKNPTIYDDAKIFNEIHEITDELRQMAGGAGSRFGTGGMTSKLAAAQILFENDQ
EMVLTNGERIREIQQIIEGREIGTYFHQKF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgattattacaagaaaaaatattttgaaagctcagcgaattgtggtgaagattggcacg
agttccttgattttgccaaatggaaaaataaatttatcaaatattgacgaactggctttt
gtcttatctgatttgaataataaaggctatgaagtgattttggtgacttctggggcgatt
ggtgtgggcttgaatgtccttggaatggataaacgtccaaaaggaatcgcagaccagcag
gctttggcttctatcggtcaggtcgaattgatgagtctttatacgcaaatgtttcgccgt
tattcacaaaaagtttcgcaattacttttgactcgtgatgtaactgattttccaacgagt
cgtgaaaatgctgaaaatgcattgaatgctctacttgcactggatattatcccgattatc
aatgaaaacgatgcaattgctgttgatgaaatggaccatcaaacaaaatttggcgataat
gataaactgggagcgattgtgtctaagttggttcatgccgatttgttgattatgctttca
gatatcgatggactttttgataaaaatccgacgatttatgatgatgctaaaatttttaat
gaaattcatgaaattactgatgaattacgccaaatggctggaggtgccggttctcgtttt
ggtactggtgggatgacttcgaaattggcggctgcccaaattttatttgaaaatgatcag
gagatggttctgaccaatggcgagcggattcgagaaattcaacaaattatcgaaggacgt
gagattggaacatattttcatcaaaaattttga

DBGET integrated database retrieval system