KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_1687Help
Entry
uc509_1687        CDS       T02415                                 

Gene name
recD
Definition
exodeoxyribonuclease V alpha chain
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lli00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    uc509_1687 (recD)
Enzymes [BR:lli01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     uc509_1687 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1683738..1686239)
Genome map
AA seq 833 aa AA seqDB search
MTDKTYVTGSIEAIFFSNPSNFYKVLLIEIDETNAEYDDFEIVVNGTIGDVVEGDSYTFY
GQLTQHPKYGEQLQVSQYEKAVPTSGAGLVKYFSSDKFPGIGKKTAEKIVETFPENTVDS
ILEAPEKLDGLLTLARKNSFIKRLRENHGMEKVLTKLAEYGLPSKLTFQIYELYKEETIE
KIEENPYQLVEEVKGVGFKTADKIASELGIEADSPNRFRAALMHEVNTHSQATGDTYIEA
KNLLELTIDLLEEARNIEVNPAEVAAEINGLIVDGKVQQEGTKIFENSLFFAEDGIRKSL
TALTNRLGKDFADEKLLTVLEEVEKDLEITYDELQKQAIIGAMNQQFFILTGGPGTGKTT
IINGFIETYARLYQLDLDPDHYNDDVFPILLAAPTGRASRRMNELTGLPAATIHRHLGLG
QDEAEDALGNELSGSLLIVDEFSMVDTWLANKLFQAIPGSMKVLLVGDADQLPSVGPGQI
FSDLLKIPEIPSVKLDKIFRQGDDSTITDLAHHIKDGQLPADFTVKKTDRSYFEVSANFV
PQTVEQIASAWQKRGNNPFELQILAPMYKGAAGINAMNILLQNLFNPLNDRLEFVLGDMK
FREGDKVLHLVNDAEANVFNGDLGQIVELIAAKYTDSKQDEIVMDFDGQELTYPRSEWYK
ITLAYAMSIHKSQGSEFSTVIVPMVSSYSRMLERNLLYTAITRAKKSLILLGEERAFAQA
VAREGANRKTFLVEHFKDDKPAAENLSVDSLTKKVTDKKEISNKEKNSGSVADLNLENFS
VRKKTAPKVEEISLFDEETESLGNGILTEALILSGNFAPLIGLTEQDFAIFNK
NT seq 2502 nt NT seq  +upstreamnt  +downstreamnt
atgacggataaaacttatgttacaggctcaattgaagctatttttttctctaatccaagc
aatttttataaagttttattaattgagattgatgaaacaaatgctgaatatgatgatttt
gaaattgtggtcaatgggacaattggcgatgtggtcgaaggggattcttatactttttat
gggcaattaacccagcatccaaagtatggggaacaattgcaagtcagtcaatatgaaaag
gctgtaccaacgtctggtgctggtttggtcaagtatttttcatcagataaatttccaggg
attggtaaaaaaacggcagagaaaattgttgaaacttttcctgaaaatacggtagattct
attttagaagcgcctgagaaattggatggtttattaactctagccagaaaaaattcattt
atcaaacgtttgcgtgaaaatcatggtatggaaaaagtgctgaccaagcttgcggagtat
ggcttgccaagtaaactcacttttcaaatttatgagttgtacaaagaggaaacgattgaa
aaaattgaggaaaatccttatcaacttgtggaagaagttaaaggggtgggctttaaaact
gccgataaaattgcgagtgaactagggattgaagcggatagtccaaatcgttttcgagcg
gctttgatgcatgaggtcaatacgcattcgcaagcaacgggtgacacttatattgaagct
aaaaacttgctggaattgacgattgatttacttgaagaagccagaaatattgaggtcaat
ccagctgaagttgctgcggaaataaatggtttaattgttgatggaaaagtacagcaagaa
ggaacgaaaatatttgaaaattccttgttttttgctgaagacggtatccgaaaatcactg
acagccttaactaatcgtttgggaaaagattttgctgacgaaaagttactgacagttttg
gaagaggtagaaaaagatttagagattacttatgatgaacttcagaaacaggccatcatt
ggagcgatgaatcagcaatttttcattttgactgggggaccaggaacggggaaaacaacg
attattaatggtttcattgaaacttatgcccgtctttatcagttagatttagaccctgac
cattataatgatgacgtttttcctattttattggcggcaccgactggtcgcgcttcaaga
cggatgaatgagttgactggacttccagcagcaacaattcatcggcacttaggcttaggg
caagatgaggcagaagatgcgcttggtaatgagttgtcaggttcacttttgattgtcgat
gaattttcaatggttgatacttggctagccaacaaactttttcaagccattcctggttca
atgaaagtccttctcgttggcgatgctgaccaacttccttctgtgggccctggacaaatt
ttttcagatttattaaaaattccagaaattccgtcagtaaaattggataagatttttcgt
cagggagatgattcaacgattaccgatttggctcatcatatcaaagatggacaattacct
gcagattttacggtgaaaaaaactgaccgttcttattttgaagtgagtgctaattttgta
ccacaaacggtggagcaaattgctagtgcttggcaaaaaagaggaaataatccttttgaa
ttacaaattttagcgcccatgtataaaggggccgctgggattaatgcaatgaatattctc
ttgcaaaatctctttaatccgcttaatgaccggcttgaatttgttttgggtgatatgaaa
tttcgtgaaggagataaggtattacatttagtcaatgacgctgaggccaatgtattcaat
ggagatttaggacaaattgttgaattgattgcagcaaaatatactgacagtaaacaagat
gagattgtgatggattttgatggtcaagaattgacctatcccagatctgaatggtataaa
attacgcttgcttatgccatgtctatccataaatcccaaggttcggaattttcaacggtc
atcgtcccgatggtctcttcttattcacggatgttagagcgaaatttactctatacagca
atcacgagggcaaagaaaagcttaattttattgggtgaagagcgtgcctttgctcaggct
gtggcgcgtgaaggagccaatcgaaaaacttttcttgttgagcattttaaggatgataag
cctgcagctgaaaatctgtcagtagattccttaactaaaaaagttactgacaagaaggaa
atatctaacaaagagaaaaattctggatcagtagcagacttaaacttagaaaatttttct
gtcagaaaaaaaacagcaccaaaagtcgaggaaatttcattatttgatgaagaaactgaa
agtttggggaatggaattctaacagaagcgctaattttatctggcaattttgctccctta
attggattgactgagcaagattttgcgatttttaataaatag

DBGET integrated database retrieval system