KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_2029Help
Entry
uc509_2029        CDS       T02415                                 

Gene name
gltX
Definition
glutamyl-tRNA synthetase
Orthology
K09698  
nondiscriminating glutamyl-tRNA synthetase [EC:6.1.1.24]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:lli00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2018555..2020006)
Genome map
AA seq 483 aa AA seqDB search
MNKKIRVRYAPSPTGLLHIGNARTALFNYLFARHHGGDFIIRIEDTDRERHVEDGERSQL
ENLRWLGMDWDESPETHENYRQSERLPLYQKYIDQLLAEGKAYYSYKTPEELEADHAKQE
AAGIPPHYINEYAGMSDDEKAAYIAERKAQNIEPVVRISVDEKAIYKWNDIVKGEIEFEG
GNIGGDWVIQKRDGYPTYNFAVVVDDHDMQISHVIRGDDHIANTPKQLVVYDALGWEAPQ
FGHMTLIINSETGKKLSKRDTNTLQFIEDYRKKGYMSDAIFNFIALLGWNPGGEKEIFSR
EELIELFDENRLSKSPAAFDQKKLDWMDNEYIKNADFAKVFELTKPFLLAANRFDERAQE
LVKLYQPQMKSADEIVELTDLFYGDFPELTDEAREMLAAETTPLALSTFRAKLAELPESD
FTVENIFPLFKATQKETGVKGKMLWMPIRIAASGSMHGPELPETIALLGKEKVLAHLDAA
LNK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaaaaatccgcgtccgttacgcaccatcaccaacaggacttttgcatatcggg
aacgcccgtacagccctttttaactatctttttgcccgtcatcacgggggagatttcatc
atccgtattgaagatacagaccgtgaacgccatgttgaagatggtgaacgttcacaactt
gaaaaccttcgttggttgggaatggattgggatgaaagccctgaaacacacgaaaattat
cgtcaatcagaacgcttgcctttgtatcaaaaatatattgaccaattgttagctgagggt
aaagcttattattcttacaaaactcctgaagaactagaagctgaccatgctaaacaagaa
gcagcaggaattcccccacattatatcaatgaatatgctggcatgagcgatgacgaaaaa
gcagcttatattgctgaacgtaaagcacaaaatattgaacctgtcgttcgtatctctgtt
gacgaaaaagccatttataaatggaatgacatcgttaaaggtgaaattgaatttgaaggt
ggcaatatcggtggcgattgggttatccaaaaacgtgatggttacccaacttacaacttt
gctgttgttgttgatgaccacgatatgcaaatttcacatgtcattcgcggagacgaccat
attgccaatacgccaaaacaattggttgtttatgatgctttaggttgggaagcgccacaa
tttggtcacatgactttgattattaattctgaaacagggaaaaaattgtcaaaacgtgac
acaaacacactccaatttatcgaagactaccgtaaaaaaggctacatgtctgatgccatt
ttcaactttattgcacttttgggttggaatcctggtggagaaaaagaaattttctctcgt
gaagaattgattgaactttttgacgaaaatcgtttgtctaaatcaccagcagcctttgac
caaaagaaattggactggatggacaatgaatacatcaaaaatgccgattttgcgaaagtt
tttgaattgacaaaaccattccttcttgccgctaatcgctttgatgaacgtgcgcaagaa
ttggttaaactttatcaaccacaaatgaaatcagcagatgagattgttgaattaacagac
cttttctacggagatttcccagaattgactgatgaagcacgcgaaatgttagctgctgaa
acaacaccacttgcattgagcactttccgtgcaaaattggctgaacttcctgaaagtgac
tttacggttgagaatattttcccactctttaaagccactcaaaaagaaacaggcgtgaaa
ggtaaaatgctctggatgccaatccgtattgcagcttcaggctcaatgcacggtccagaa
ttaccagaaacgattgctcttcttggaaaagaaaaggtattggctcacttggatgccgct
ttaaataaataa

DBGET integrated database retrieval system