KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_2084Help
Entry
uc509_2084        CDS       T02415                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lli00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    uc509_2084 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    uc509_2084 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    uc509_2084 (thrC)
Enzymes [BR:lli01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     uc509_2084 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2058877..2060367)
Genome map
AA seq 496 aa AA seqDB search
MVTFYQSTRDKSNKKTASQAILQGLAEDGGLFVPVDFPKVDLDFEKLKNASYQEIAELVL
KAFFDDFSADEIKSMVTKAYGEKFDSPEIAPLKRLGNHYILELFHGETIAFKDMALSILP
HLMTQAAKKNGVTNEIVILTATSGDTGKAAMAGFSDVPQTKIIVFYPKGGVSHIQEQQML
TQKGANVHVVGIDGNFDQAQTAVKEMFNNKVLHDQLLKNNKQFSSANSMNIGRLIPQVAY
YIYAYAQLVKTGQITDGEKINFSVPTGNFGNILAAYYSKKLGLPVHQLICASNKNNVLTD
FFKTGLYDKNREFYVTSSPSMDILVSSNLERLIFDLTDENDDETLALLTALSAEGHYQIS
KKMMSKLQGFIADWASEEEISQEINETFENENYVLDPHTAVANYVYHQIQPKEKTVVVST
ASPYKFPKVVLEGLQKSGTDLSEKIDDFAAVKSLEKLSGIPLPKAVLGLEKAEILHHTVV
PVQEMQKEVEKYLGLK
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggtaactttttatcaatcaacacgggataaatcaaataaaaaaacagcctcacaagct
atcttgcaaggtttggcagaagacggtggactttttgttcctgttgacttcccaaaagtt
gatttagactttgaaaaattaaaaaacgcttcttatcaagaaattgctgaacttgttttg
aaagcattttttgatgatttttctgctgacgaaattaaatcaatggttacaaaagcatac
ggagaaaaattcgatagtccggaaattgcaccgcttaaaagacttgggaatcactatatt
cttgaactttttcatggtgaaacgattgcttttaaagacatggcactctctatcttacct
catttaatgacccaagcggctaagaaaaatggtgtgaccaatgaaattgttatcttgact
gcaacttctggagatacaggaaaagccgcaatggctggtttttctgatgtgccccaaaca
aaaattattgttttttatcccaaaggtggtgtcagccatattcaagagcaacaaatgctg
acccaaaaaggggctaatgttcacgttgttggaattgatggaaattttgaccaagctcaa
acagcagtaaaagaaatgtttaataacaaagttttacatgatcaacttttgaaaaataat
aaacaattttcgtcagcaaattcaatgaatattggacgtttgattccgcaagtcgcttat
tatatttatgcttacgcacaactggtcaaaactggtcaaattactgacggagaaaaaatc
aatttttcagttccgacaggaaattttggaaatattttagccgcttattattctaaaaaa
ttgggcttgcccgttcatcagctcatctgtgcttcaaataaaaataatgtgctgacagac
tttttcaaaacaggactttatgataaaaatcgagaattttatgtgacaagttcaccgtca
atggatattttggtttcttcaaatcttgaacgattgatttttgatttaactgacgagaat
gatgatgagactttggctttactgacagctttgtcagcagaaggtcattatcaaatttct
aaaaaaatgatgagtaagttacaaggttttatagctgactgggcatcagaagaagaaatt
tcccaagaaattaatgaaacttttgaaaatgaaaactatgttcttgacccccacacagcg
gttgcaaactatgtctatcatcaaattcaaccaaaagaaaaaacagttgttgtcagcact
gccagcccttataagttccctaaagttgttttagaaggacttcaaaagtcaggaacggac
ttgtcagagaagatagatgattttgctgccgttaaatcacttgaaaaactcagtggtatt
ccattacccaaagctgtgttagggcttgaaaaagctgaaattttgcatcatacagtagtt
ccagttcaggaaatgcaaaaagaagtagagaaataccttggtttaaaatga

DBGET integrated database retrieval system