KEGG   Lactococcus lactis subsp. cremoris UC509.9: uc509_2199Help
Entry
uc509_2199        CDS       T02415                                 

Gene name
asnH
Definition
Asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
lli  Lactococcus lactis subsp. cremoris UC509.9
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:lli00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2187078..2188955)
Genome map
AA seq 625 aa AA seqDB search
MCGIVGFIDRMDQNDKSKTLEEMMDTIAHRGPSSSGEFIDEGAAIGFRRLSIIDLEGGDQ
PIFNEDKTKLITFNGEIYNFRELREDLISKGHDFTTHADTEVLLHGYEEYGVELLQKLRG
MFAFVIWDREKQELFGARDHFGIKPLYYTQMNGTFMYGSEIKSFLKHPNFKKELNKEALK
PYMTFQYSALDETFFKNVFRIKEGHYFTYKDGVLDIKPYWDMKVDEKDMSLEESIDLIDK
TVLGSVDAHKFADVEVGAFVSSGVDSSYVASTLRPEHTYSIGFGQGTFNESKQAKQLTDM
IGLNNTSREIHGDEAFKYFPQIQYYLDEPDSNPSCVPLFFLAELAARDVRVVMSGEGADE
LFAGYESYGFSTNSRAVRVFAEGLKKLPKSLRFSIARGIENKHFKGQKHLYESLAPAEDF
FIGQAKVFDESESVELLKEEFQAALTVKEIVGKTYKKAPEGSELRKMQYLDMHQWMPGDI
LLKADKMAMAHSLELRVPLLDIELMHTAEQIPSKFLLNEHNTKYAFRQAARRHLPEEWSN
RKKLGFPVPIKDWLREEKYYKVVRQLFEQDFVAEIFDQEKLLKMLDDNFADKNDARRKLW
TIYSFLTWYDVYFINNGEKPAVVNF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtcggctttattgaccggatggatcaaaatgataaatcaaaaacttta
gaagaaatgatggatacaatcgctcaccgaggtccaagtagttcaggtgaatttattgac
gaaggagcagcaattggttttcgtcgcctgagtattattgaccttgagggtggcgatcaa
cctatctttaatgaagataaaactaaacttataacctttaatggcgaaatttataatttc
cgtgaattgcgtgaagaccttatctctaaaggtcatgattttactactcatgctgataca
gaagtgcttttacatggttacgaagaatacggtgtagagcttcttcaaaaacttcgtgga
atgtttgctttcgtgatttgggatagagaaaaacaagaattgtttggtgcacgcgatcat
ttcgggatcaagcctctttactatactcaaatgaacggaactttcatgtatggttctgaa
attaaaagctttttgaaacatccaaacttcaaaaaagaattaaataaagaagctttgaaa
ccttatatgactttccaatattctgctcttgatgaaactttctttaaaaatgtttttcgt
atcaaagaaggacactactttacatataaagatggggttttagatattaagccttattgg
gatatgaaagttgatgaaaaagatatgagcttggaagaatcaattgatttgattgataag
accgttttgggttctgttgatgctcataagttcgctgatgttgaagtgggtgcttttgta
tcaagtggtgtagattctagttatgttgcttcaacgcttcgtcctgaacacacttattct
attggtttcggtcaaggaactttcaatgagtctaaacaagccaaacaattaactgatatg
attggtttgaataatacttctcgtgaaattcatggggacgaagcttttaaatatttccca
caaattcaatattatttagatgaaccagattcaaatccttcttgtgttcctctctttttc
cttgctgaattggcagctcgtgatgtacgggttgtaatgagtggtgaaggagcagatgag
ctctttgctggttatgagtcttatggatttagtaccaattctcgcgcggttcgtgttttt
gcagaaggtttgaagaaattaccaaaatctttacgtttctcaattgctcgtggaattgaa
aataaacatttcaaaggacaaaagcatctatatgaatcacttgcaccagctgaggacttc
ttcatcgggcaagcaaaagtatttgatgagtctgaatcagttgagcttttgaaagaagaa
tttcaagcggctctaacagtcaaagaaattgttggaaaaacttataaaaaagcaccagaa
ggttctgaacttcgtaaaatgcaatatcttgatatgcaccaatggatgccaggagatatc
ttgcttaaagcagataaaatggctatggcacattcacttgaattacgtgtcccattgtta
gacattgaattgatgcacacagccgaacaaattccttctaaattccttttgaatgaacac
aatacaaaatatgctttccgtcaagcagctcgtcgtcatttgccagaagaatggtcaaat
cgtaaaaaattgggattcccagtgccaattaaagactggttaagggaagagaagtattat
aaagttgttcgtcaattgtttgaacaagactttgttgcagaaattttcgaccaagaaaaa
cttttgaagatgttggatgataactttgcagataaaaatgatgctcgtcgtaaactctgg
acaatttattcattcttgacttggtatgatgtttacttcatcaataatggtgaaaaacct
gctgtggttaatttttaa

DBGET integrated database retrieval system