KEGG   Lactococcus lactis AI06: LG36_1738Help
Entry
LG36_1738         CDS       T03480                                 

Gene name
fadA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llj  Lactococcus lactis AI06
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:llj00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LG36_1738 (fadA)
   00630 Glyoxylate and dicarboxylate metabolism
    LG36_1738 (fadA)
   00640 Propanoate metabolism
    LG36_1738 (fadA)
   00650 Butanoate metabolism
    LG36_1738 (fadA)
  Lipid metabolism
   00071 Fatty acid degradation
    LG36_1738 (fadA)
   00072 Synthesis and degradation of ketone bodies
    LG36_1738 (fadA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LG36_1738 (fadA)
   00310 Lysine degradation
    LG36_1738 (fadA)
   00380 Tryptophan metabolism
    LG36_1738 (fadA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LG36_1738 (fadA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LG36_1738 (fadA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LG36_1738 (fadA)
Enzymes [BR:llj01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LG36_1738 (fadA)
Exosome [BR:llj04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LG36_1738 (fadA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1902640..1903788
Genome map
AA seq 382 aa AA seqDB search
MSFKNPVGIITANRLPIGKINGFYKKISPETLYQNLIKQQFNKNPLLKKADIDYIILGNV
TNQGGNLARRCALKAGFSSNIPAFTIDQQCGSGLTAMISSANYIISGEASIICTGGVEST
SQANIVLDSESHQPINRFKMAPDPYEDFDMGTIADMSALKYNISRSIQDLYALNSHKKAT
QAIEGKLLENEIFPYQDEEFTISSDQTVRPKSSIEDLSKLTPAFTTNGTATAGNSCPIND
GASSIILSSTNNPFDFQGYYLGQTTVALSPSDFLLGPIKATEKLLQKFSLKLNDIEAIEL
NEAFASQAILFQNYFKLDDIKLNAYGGALAFGHPYGATGGILISRLLNRLNQVQKPCLGI
ATLCVAGGMGISVLIGNHWYQK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagctttaaaaatcccgtcggtattataacagcaaaccgtttacctataggaaaaatc
aatggtttttataaaaaaatttctcctgaaactttatatcaaaatctaattaaacaacaa
tttaataaaaatccccttctcaaaaaagctgatattgactatattattttgggaaatgtg
actaaccaaggaggaaatttagctcgacgttgcgctttaaaagcaggattctcgagcaac
atcccagcttttacaattgaccagcagtgcggttctggactgacagctatgattagctct
gcaaattacattatttctggtgaagcttccattatttgtacaggaggggtagaaagcaca
tctcaagccaatatcgtacttgattcagagagtcatcagccgattaaccgatttaaaatg
gctcctgacccctatgaagattttgacatgggaacaattgccgatatgtcagccctaaaa
tacaatatttctcgtagtattcaagacctttacgctctaaatagtcataaaaaagcgact
caagccattgaaggaaaacttttagaaaatgaaatttttccctatcaagatgaagaattt
acaataagtagtgatcaaactgttcgccctaaatcctcaatagaagatttgagcaaatta
acccctgcttttaccactaacggaacagccactgctggaaactcttgtccaataaacgac
ggtgcttcttcaatcatattgtcatccactaataacccttttgattttcaaggctattat
ttaggacaaacaactgttgctttatctccatcagatttcttattaggcccaataaaagca
actgaaaaacttttacagaaattttcccttaaacttaatgatattgaggctatcgaatta
aatgaagcatttgccagtcaagccattttattccaaaattattttaagcttgatgatata
aaattaaatgcttatggtggtgcccttgcatttggtcatccttacggtgcaactggtggc
attctaatttctcgactcttaaatcgcctaaatcaagtgcaaaaaccatgtcttggcatc
gcaactttgtgcgtagctggaggtatgggaatcagtgtactgataggtaatcactggtat
caaaaatga

DBGET integrated database retrieval system