KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0363Help
Entry
LLKF_0363         CDS       T01141                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:llk00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:llk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
356562..357827
Genome map
AA seq 421 aa AA seqDB search
MKKIVINGGKRISGTIPISGAKNSVVALIPATILANDVVTLEGVPDISDVASLVEIMEIM
GAKIERNLEEGRLVIDTRSVVSRPLPYGKINSLRASYYFNGALLGRFGQATVGLPGGCDL
GPRPTDLHDKAFKALGAKKIQEEEAEHLEVIGDSLVGTTIYMDVVSVGATINTMLAASRA
KGLTIIENAAREPEIIDVATLLNNMGAQVRGAGTDIIRITGVDEMHGAQHTVIPDRIEAG
TYLALAAAMGDGVIIENVIYEHLESFIAKLEEMGVGLTIREDSIEVHKSENLKSVNITSV
PYPGFATDLQQPITPLLLKAKGRGSIVDTIYQKRVNHVPELARMGANISVLDDRIIYDAP
NELTGSCVQATDLRAGAALVTAGIIASGTTKISNIEFILRGYDHIIEKLTAVGVDIQLIE
E
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagtaattaatggtgggaagcgtatttcaggaaccatcccaatttctggc
gcaaaaaattcagtagtcgctttgattccagcaactatcttagctaacgatgttgtaacg
cttgaaggagttccagatatttctgatgtcgcaagtttagtcgaaatcatggaaatcatg
ggagcaaaaattgaacgaaatcttgaagaaggacgacttgtgattgatacacgcagtgtt
gtttctcgtccccttccttatggaaaaatcaactctttacgtgcttcttattatttcaat
ggggcacttttgggacgttttggtcaggcaacagtaggtttgcctggtggctgtgattta
ggccctcgtccaacggatttacatgataaagcctttaaagctctaggggctaagaagatt
caagaagaagaagctgagcacttagaagtgattggtgattcgttagttggaacaaccatt
tatatggatgttgtttctgttggggcaacaattaatactatgcttgctgctagtcgtgca
aaaggtttaactatcattgaaaatgctgcccgtgaacctgagattattgatgtggcgaca
cttctaaataatatgggcgcacaagttcgaggagctggaactgacattatccgcattact
ggagtggatgaaatgcacggtgctcaacatacggtgattcctgaccgtattgaagcggga
acttatcttgccttagctgctgctatgggagatggtgtcatcatcgaaaatgttatttat
gaacacttggaatctttcattgctaaacttgaagaaatgggtgtaggtttgaccattcgt
gaagatagtattgaagttcataaatcagagaatctaaaatcagtcaatattacttctgtt
ccttacccagggtttgcgacggatttgcaacaaccaattacaccacttttattgaaagca
aaaggtcgtggttcgattgttgatacgatttatcaaaaacgtgtcaatcatgtccctgaa
ttagctcgtatgggtgctaatatttctgttttagacgatcgaattatttatgacgctcct
aatgaattaactggtagttgtgttcaagcaactgacttacgtgctggtgcggctttggtt
actgctggaattattgccagtggaactacaaaaatctctaatattgagtttatcctacgt
ggttatgaccacattattgaaaaattgactgctgttggtgtagatattcaattgattgaa
gagtga

DBGET integrated database retrieval system