KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0391Help
Entry
LLKF_0391         CDS       T01141                                 

Gene name
pmg
Definition
(GenBank) Phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00010  Glycolysis / Gluconeogenesis
llk00260  Glycine, serine and threonine metabolism
llk00680  Methane metabolism
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01120  Microbial metabolism in diverse environments
llk01130  Biosynthesis of antibiotics
llk01200  Carbon metabolism
llk01230  Biosynthesis of amino acids
Module
llk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
llk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_0391 (pmg)
  Energy metabolism
   00680 Methane metabolism
    LLKF_0391 (pmg)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLKF_0391 (pmg)
Enzymes [BR:llk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LLKF_0391 (pmg)
Membrane trafficking [BR:llk04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LLKF_0391 (pmg)
Exosome [BR:llk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LLKF_0391 (pmg)
  Exosomal proteins of melanoma cells
   LLKF_0391 (pmg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: ADA64161
UniProt: D2BN99
Position
381461..382162
Genome map
AA seq 233 aa AA seqDB search
MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKR
AIKTTNLALEYSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFWEDQIAPALKEGKNVFVG
AHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNVQNEYYLAPKKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttgcacgtcacggtgaatctgaatggaatcttgctaaccttttc
acaggttgggctgacgttgacctttctgaaaacggaactaaacaagcgattgaagctggt
aaattgattaaagaagctggaatcgaatttgatattgcttacacttcagtattgaaacgt
gctatcaaaacaactaaccttgctcttgaatattcagatcaactttgggtaccagttgtt
aaatcatggcgcttgaacgaacgtcactacggtggtttgacaggtttgaacaaagctgac
gctgctgcaaaacatggtgatgaacaagttcacatctggcgtcgttcatatgatgtattg
ccaccagcaatggatcatgatgataaatatacagctcacggagaccgtcgttacgctggt
cttgaagattcattgattcctgatgctgaaaacctcaaagttactttggaacgtgctctt
ccattctgggaagaccaaatcgctccagctttgaaagaaggaaaaaatgtcttcgttggt
gctcacggtaactcaatccgtgcactcgttaaacaaatcaaaaaactttctgatgacgaa
attatggatgttgaaatccctaacttcccaccacttgttttcgaatttgatgacaacttg
aacgttcaaaacgaatactacttggctcctaaaaaagcataa

DBGET integrated database retrieval system