KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0391Help
Entry
LLKF_0391         CDS       T01141                                 

Gene name
pmg
Definition
(RefSeq) phosphoglycerate mutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLKF_0391 (pmg)
   01230 Biosynthesis of amino acids
    LLKF_0391 (pmg)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_0391 (pmg)
  Energy metabolism
   00680 Methane metabolism
    LLKF_0391 (pmg)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLKF_0391 (pmg)
Enzymes [BR:llk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LLKF_0391 (pmg)
Exosome [BR:llk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LLKF_0391 (pmg)
  Exosomal proteins of melanoma cells
   LLKF_0391 (pmg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
381461..382162
Genome map
AA seq 233 aa AA seqDB search
MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKR
AIKTTNLALEYSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFWEDQIAPALKEGKNVFVG
AHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNVQNEYYLAPKKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttgcacgtcacggtgaatctgaatggaatcttgctaaccttttc
acaggttgggctgacgttgacctttctgaaaacggaactaaacaagcgattgaagctggt
aaattgattaaagaagctggaatcgaatttgatattgcttacacttcagtattgaaacgt
gctatcaaaacaactaaccttgctcttgaatattcagatcaactttgggtaccagttgtt
aaatcatggcgcttgaacgaacgtcactacggtggtttgacaggtttgaacaaagctgac
gctgctgcaaaacatggtgatgaacaagttcacatctggcgtcgttcatatgatgtattg
ccaccagcaatggatcatgatgataaatatacagctcacggagaccgtcgttacgctggt
cttgaagattcattgattcctgatgctgaaaacctcaaagttactttggaacgtgctctt
ccattctgggaagaccaaatcgctccagctttgaaagaaggaaaaaatgtcttcgttggt
gctcacggtaactcaatccgtgcactcgttaaacaaatcaaaaaactttctgatgacgaa
attatggatgttgaaatccctaacttcccaccacttgttttcgaatttgatgacaacttg
aacgttcaaaacgaatactacttggctcctaaaaaagcataa

DBGET integrated database retrieval system