KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0395Help
Entry
LLKF_0395         CDS       T01141                                 

Gene name
recR
Definition
(GenBank) Recombination protein recR
  KO
K06187  recombination protein RecR
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:llk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LLKF_0395 (recR)
DNA repair and recombination proteins [BR:llk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     LLKF_0395 (recR)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LLKF_0395 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Toprim_4 RecR Toprim HHH HHH_8 HHH_5 IMS_HHH
Motif
Other DBs
NCBI-ProteinID: ADA64165
UniProt: D2BNA3
Position
386964..387560
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLSFCSIC
GNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPD
EINVKTLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPAGIKVTRLARGLAVGSDI
EYADEITLSKAVENRLEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatcctgaacctattgctcgcctgattgagtcgttttcaaaattaccagggatt
ggtcaaaaaacagcgactcgattggctttttatacgattggcatggaagatcaagatgtc
aatgaatttgcaaaaaatcttctgtcagcaaaacgggatttgagtttttgctcgatttgt
gggaatttaacagaaagtgatccttgcgccatttgtaccgacccaacgcgtgatcgaaca
actatattggtcgttgaagaatctaaagatgttcttgctatggaaaaaattcgggaatat
cgaggactttatcatgttttgcatggtacgattagtccaatgaatgggatttctcctgat
gaaattaatgttaaaacattgattacaagattaatggattcagaggttaaagaagtgatc
atcgcaactaatgccacttctgacggagaagcaaccgccatgtatctggctcgaatgatt
aagcctgcaggaattaaagtgactcgcttggctcgtggattagctgtaggatctgatata
gaatacgcagatgaaattactttatcaaaagcggtagagaatcggttggaaatttga

DBGET integrated database retrieval system