KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0395Help
Entry
LLKF_0395         CDS       T01141                                 

Gene name
recR
Definition
recombination protein Recr
Orthology
K06187  
recombination protein RecR
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:llk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LLKF_0395 (recR)
DNA repair and recombination proteins [BR:llk03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      LLKF_0395 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
386964..387560
Genome map
AA seq 198 aa AA seqDB search
MYYPEPIARLIESFSKLPGIGQKTATRLAFYTIGMEDQDVNEFAKNLLSAKRDLSFCSIC
GNLTESDPCAICTDPTRDRTTILVVEESKDVLAMEKIREYRGLYHVLHGTISPMNGISPD
EINVKTLITRLMDSEVKEVIIATNATSDGEATAMYLARMIKPAGIKVTRLARGLAVGSDI
EYADEITLSKAVENRLEI
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgtattatcctgaacctattgctcgcctgattgagtcgttttcaaaattaccagggatt
ggtcaaaaaacagcgactcgattggctttttatacgattggcatggaagatcaagatgtc
aatgaatttgcaaaaaatcttctgtcagcaaaacgggatttgagtttttgctcgatttgt
gggaatttaacagaaagtgatccttgcgccatttgtaccgacccaacgcgtgatcgaaca
actatattggtcgttgaagaatctaaagatgttcttgctatggaaaaaattcgggaatat
cgaggactttatcatgttttgcatggtacgattagtccaatgaatgggatttctcctgat
gaaattaatgttaaaacattgattacaagattaatggattcagaggttaaagaagtgatc
atcgcaactaatgccacttctgacggagaagcaaccgccatgtatctggctcgaatgatt
aagcctgcaggaattaaagtgactcgcttggctcgtggattagctgtaggatctgatata
gaatacgcagatgaaattactttatcaaaagcggtagagaatcggttggaaatttga

DBGET integrated database retrieval system