KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0408Help
Entry
LLKF_0408         CDS       T01141                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:llk00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    LLKF_0408 (mutM)
Enzymes [BR:llk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     LLKF_0408 (mutM)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     LLKF_0408 (mutM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
404783..405601
Genome map
AA seq 272 aa AA seqDB search
MPELPEVETVRRELEKRIVGQKIVSIEATYPRMVLTGFEQLKKELTGKTIHGISRRGKYL
IFEIGEKDRLISHLRMEGKYRLASLNVPMEKHDHLALKFTDEQLIYADVRKFGTWELIST
DQVLPYFLKKNIGPEPTYETFDEQIFREKLQKSTKKIKPFLLEQTLVAGLGNIYVDEVLW
LEKIHPEKMANQLTESSIHLLHDSIIEILQKAIKLGGSSIRTYSALGSTGKMQDELRVYG
KTGEKCVRCGNEIQKIKVAGRGTHFCPFCQQK
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgccagagttaccagaagttgaaacagtgagaagagagcttgaaaaaagaattgttgga
caaaaaattgtatctatagaagccacttatccaagaatggttttaactggttttgagcaa
ttgaaaaaagaattgacaggaaaaaccattcatggcatttcacgtcgcggaaaatattta
atttttgaaattggcgagaaagatcgtttgatttctcatctgcggatggaaggaaaatat
cgacttgcaagcctcaatgttccaatggaaaaacatgaccatttagcccttaaatttact
gacgaacaattaatttatgctgacgtaagaaaatttggaacttgggaattgatttctact
gaccaagtccttccatatttcttgaagaaaaacattggtccggagccaacttatgaaact
tttgatgaacagattttccgagaaaaattgcagaaatcgacaaagaaaattaaacctttt
ctacttgaacaaacattagtggctggacttggaaatatttacgttgacgaagtactctgg
ctagaaaagattcatccagaaaaaatggcaaatcaactgacagaaagttctattcatctt
ttacatgattctatcattgaaattttgcaaaaagcaattaaattaggcggctcaagcatc
agaacttatagtgccttaggttcaacaggaaaaatgcaggacgaattacgagtgtatgga
aaaacaggggaaaaatgtgtgcgttgtggcaatgaaattcaaaaaataaaagtggctggt
cgggggacccacttttgcccattctgtcagcaaaaataa

DBGET integrated database retrieval system