KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0673Help
Entry
LLKF_0673         CDS       T01141                                 

Gene name
pbg
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:llk00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
686874..688325
Genome map
AA seq 483 aa AA seqDB search
MTFKPDFLWGGATAANQFEGAFLEDGRGWSTADTAKYYPHSDKTSMDSLMDPMTTSKIEF
AKKDLEGIYPKRYGIDFYHHFKEDIALFAEMGFKTFRMSISWSRIFPNGDELEPNETGLK
FYDQVFDELLKYHIEPLVTMSHYEFPLGLALKQNGWESRETVDHFEKYARVILNRYKDKV
KYWLTFNEINIIGITGYLSGGLLADKTQNMLQSQFQAAHHQFLASALAVKACHEIIPEAK
IGCMLARMETYPETCNPLDVMATIDSDHANLFYSDVQVRGYYPTYMKKVFKDHHLKIIKE
SGDDQLLKEGKVDFMSFSYYMSSISSSSEEGEVIGGNFTQTKKNPYLKSSDWGWQIDPVG
LRITLHKLYDRYQVPLFVVENGLGAHDTLEEDGTIHDNYRIDYLREHIKQMGIAIDEGVD
LMGYTPWGCIDLVSASTSEMSKRYGFIYVDQDNEGEGSLKRFKKDSFYWYKSVIQSNGET
LYK
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgacatttaaaccagattttttatggggaggggctacagccgctaatcaatttgaaggg
gcatttttggaagatggtcgaggttggtcaactgctgatacagctaaatactatcctcat
tctgacaaaacatcgatggattcactgatggaccctatgactacgtcaaaaattgagttt
gcaaaaaaagatttggaagggatttatccaaagcgttatggaatagatttctatcatcat
tttaaagaagatattgcattatttgcggaaatgggatttaaaacttttcgaatgtccatt
tcatggtcacgtatttttccgaatggagatgaattagagcccaatgaaactggccttaaa
ttttatgaccaagtgtttgatgagttgttaaaatatcatattgagcctttagtaacaatg
tctcattatgagtttcctttagggctagctttaaaacaaaacggttgggaaagccgtgaa
acagtggaccattttgaaaaatatgctcgagtaattttaaatcgttataaggataaagtg
aagtattggctcacttttaatgaaatcaatatcattggtatcacgggttacttaagtgga
ggtttattagctgataaaactcaaaatatgttacaatctcaatttcaagctgcgcatcac
caatttttagctagtgcattagctgtaaaagcttgtcatgaaattattccagaagctaag
ataggatgtatgttagcacgtatggaaacttatcctgaaacttgcaatccattagacgtt
atggcaacaattgattcagaccatgcgaatcttttctatagtgatgttcaggtgagaggc
tattacccaacctatatgaaaaaagtcttcaaagatcatcatttaaagattattaaggaa
tcgggagacgatcaacttttaaaagaaggaaaagtggactttatgtcttttagttactat
atgagctctatctcttctagttctgaagaaggggaggtcattggcggtaattttactcag
accaagaagaatccctatctaaaatcgagcgattggggttggcaaattgatcccgtcgga
cttcgcatcactctccataaactttacgatcgatatcaagtaccactttttgtagttgaa
aatggattaggtgcgcacgatactctagaagaagatggaacgatacatgacaattatcgt
attgactatttaagagagcatatcaagcaaatgggtattgcgattgatgaaggggttgat
ttaatgggatatacgccttgggggtgtattgatttagtcagtgcaagtacaagtgagatg
agcaaacgttatggtttcatttatgtcgatcaagataatgaaggagaaggaagcttaaaa
aggtttaaaaaagattcattttattggtataaatcagtaattcagtctaatggtgaaacc
ttgtataaataa

DBGET integrated database retrieval system