KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0714Help
Entry
LLKF_0714         CDS       T01141                                 

Gene name
ygjD
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LLKF_0714 (ygjD)
Enzymes [BR:llk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     LLKF_0714 (ygjD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
722071..724074
Genome map
AA seq 667 aa AA seqDB search
MLTNNFSIEPYGKKAYHTGIAVPVFSLRTENSSGVGQFSDLKELADFAHRSGMDIIQLLP
INDTSTFMDWRDSYPYRAISVFALHPIYLDIHIFWDSYTKIQQEKLLIAELELNALEKID
YEKALALKWEYAEIIYQNSAHKFKASKDYQQFYQQNEDWLKAYAAFSYLRDINQSANFMN
WGKYATYSEDFFEKLTSESNQLDLYIFVQYLLHYQLSEAVDYCHQLGIALKGDIAIGIAH
DSVDAWTHPELFHLDKQAGAPPDIFAVNGQNWGFPTYNWKKMAEDGYAWWKKRLTAMSNY
FDAYRLDHILGFFRIWQMPEDSVRGLLGQFSPAIALSAEEIENSYGIPLRQWGLERFINP
FIKDWVIDEIFGRDNRDWIIQTFLDYIGNGNYTFQNEYNNQKKVEKAQLEDWVREGLYKL
HENIILLKDDENPEKYHPRISLIQTISFREFGDDYKGRLEKLYNDYFYGRNYEFWKEKAY
EKLPVLKDATNMLACGEDLGMVPANVPDVMNHLNILRLIIERMPSDNRFVSPLNEVPYLS
VLTTSSHDTSPLRAWWEENHEEIQRYYNEVMGWYGEAPYYASAEIIQEIVKRHLNSNAMM
VILPIQDWLAMSEQLRKEDAKSEQINIPANPYHYWNYRLHCQLETLIDNQDWTEFLKKFI
KESKRAY
NT seq 2004 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccaataatttttcaattgaaccttacggaaaaaaagcttaccatacagggata
gcagttccagttttttcactaagaactgaaaactcaagtggggtagggcaattttcagat
ttgaaagagttagccgattttgcccaccgttctgggatggacatcattcaattattacca
attaatgataccagtacttttatggactggcgtgattcatatccttatcgtgccatttct
gtttttgcattgcatccaatttatttagatattcacatcttttgggattcttacacaaaa
attcaacaagaaaagcttctcatcgcggaattagaattaaatgctttagaaaaaatagat
tatgaaaaagcattagccttaaaatgggaatatgctgaaattatttatcaaaactcagct
cataaatttaaagcaagcaaagattatcagcaattttatcagcaaaatgaggattggtta
aaggcctatgcggcattttcgtatttaagagatatcaatcaaagtgctaattttatgaat
tggggaaagtatgccacttatagtgaagatttctttgaaaagttaacttcagaaagtaat
caattggatttgtatatctttgtgcaataccttttgcattatcaactttcagaagccgtt
gactattgtcatcaattaggaattgcactaaaaggagatatcgcaattggaattgctcat
gattccgtagacgcttggactcatccagaactttttcatcttgataaacaagctggcgct
cctcctgatatttttgctgtaaatggacaaaattggggctttccaacctacaattggaaa
aaaatggccgaagatggttatgcatggtggaaaaaacggttaacagccatgtctaattat
tttgatgcttatcggctggaccatattcttggtttctttagaatatggcagatgccagag
gattccgtaagaggtttattgggccaattttcaccagctattgccttgtcagcagaagaa
attgaaaatagctatggtattccattaaggcaatggggcctcgagcggtttattaatcct
ttcatcaaggattgggtaattgatgaaatttttggccgagataatcgagattggattatt
caaacatttctggattatataggtaatggaaattatacatttcaaaatgagtataataac
cagaaaaaagtagaaaaagctcaattagaagattgggtgcgagaaggactttataaatta
catgaaaacataatattattaaaagatgatgagaatccagagaaatatcatccacgtatt
tctttaatacaaacaatcagctttcgagaatttggtgatgactataaaggacggcttgaa
aaactttataatgactatttttatggaaggaattatgaattttggaaagaaaaggcctat
gaaaaattaccagttttaaaagatgctacgaatatgttggcttgtggtgaagatttagga
atggttcccgccaatgtaccagatgtcatgaatcatcttaatattctacgtttgataatt
gagagaatgccttcagataatcgatttgtcagtcctttaaacgaagttccctatttatcg
gtcctaacgacttcaagtcacgatacaagtccactaagagcttggtgggaagaaaatcat
gaggaaattcaacgttactacaatgaagtcatgggttggtatggcgaagctccttattat
gcaagtgcagaaattatccaagagatagttaaaaggcatttaaactccaatgcgatgatg
gttatcttacctattcaagattggttagcaatgagtgaacaattgcgaaaagaagatgca
aaatccgaacaaattaatattccagcaaatccataccattactggaattaccgattgcat
tgtcaacttgaaacattgattgataatcaggattggactgaatttttaaagaaatttatc
aaagaaagtaaaagggcctattaa

DBGET integrated database retrieval system