KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_0837Help
Entry
LLKF_0837         CDS       T01141                                 

Gene name
pbg
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_0837 (pbg)
Enzymes [BR:llk01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     LLKF_0837 (pbg)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
862358..863719
Genome map
AA seq 453 aa AA seqDB search
MENKMPKDFFWGNSTSSMQTEGGWNEGGKGPSVYDVNTAGRSAKDWQVTNDNYHHYSQDL
DLMKEMNMNMYRFQISWSRIVPDGDGEFNEEGIAFYNRLIDDLLARGIEPMICLYHFDMP
LNLAEKYNGFLSRKVKEAFVRFGQEMMKRFADKVKYWIVFNEHNLYFADGFEHYSGVLKK
ELTLSDMYTVFHHTMLAHCELTQFLHENFEAKIGGMLATTEIYPATFSPKDNLYLRKFDE
FYNRNLCDVYAFGHYSHEVMTYVKNQNIQMDFQKGDEEILKNGISDFISFSYYRSILLDA
SQLTENDAPNSYLTKGMKLNPLLEHNQWDWSIDPEGFRRILSRLYNEFGLPVFPIENGIG
QSEIWDGKTKIADDLRISYHQKHLEAMKKAIFTDGVEVMGYLGWGLIDIPASSGAIDKRY
GAVYVDPKSHKRIPKKSFHWFKNVFASNGDHLD
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaaatgccaaaagattttttctgggggaattcaacttcgtcaatgcaaacc
gaaggcggctggaatgaaggaggaaaagggccctctgtctatgatgtgaataccgctgga
cgttctgccaaagattggcaagtaacaaatgataattatcatcattattcacaagatcta
gatcttatgaaagaaatgaatatgaatatgtatcgtttccaaatttcttggtcacgaatt
gttcctgacggcgatggtgaatttaatgaggaaggaattgccttttataatcgtctgatt
gatgatttgcttgctcgtggaattgagcctatgatatgtctctatcatttcgatatgcca
ttaaatctggctgaaaagtacaatggttttttgagtcgaaaagtgaaagaagcatttgta
agatttgggcaagaaatgatgaaaagatttgctgacaaagtcaaatattggattgttttt
aatgagcataatctttattttgctgacggttttgagcattattcgggagttttgaaaaaa
gagctgacactctctgatatgtatactgtttttcatcacaccatgcttgctcattgcgaa
ttaacccaatttttgcatgaaaattttgaagcaaaaataggaggaatgttggcgactacg
gaaatatatcccgcaactttttcaccaaaagataatttatatcttagaaaatttgatgaa
ttttataatcgaaatctctgtgatgtttatgcttttggtcattattcgcatgaggttatg
acctatgttaaaaatcagaacatccaaatggattttcaaaaaggagatgaagaaatttta
aaaaatggaatttctgactttatttctttttcttattatcgctcaattttacttgatgca
agtcagctgacagaaaatgatgcaccaaattcttatttgactaaaggaatgaaattaaat
ccgttgcttgaacataatcaatgggattggtccattgacccagaaggctttagaagaatt
ctaagtagattatataatgaatttggattgcctgtttttcctattgaaaatggcattggt
cagtcagaaatctgggatgggaaaacaaaaattgctgatgacttgagaatttcttatcat
cagaaacatcttgaagccatgaaaaaggcaatatttactgacggggtagaagttatgggt
tatcttggttggggattgattgatattcctgcttcatctggtgctattgataaacgttac
ggtgctgtttatgtggatccaaaaagtcataaacgtattccaaaaaaatcatttcattgg
tttaaaaatgtatttgcttcaaatggtgatcatttggattag

DBGET integrated database retrieval system