KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1133Help
Entry
LLKF_1133         CDS       T01141                                 

Gene name
ylbD
Definition
UDP-N-acetylmuramyl tripeptide synthase (EC:6.3.2.-)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:llk00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:llk00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1142157..1143506)
Genome map
AA seq 449 aa AA seqDB search
MTIKTSFAKFAGNSSRFVLEKFFKRGSTLPGKIALKFDPEILKSLTKNYEIIVVTGTNGK
TLTTALTVGILEKAFGPVVTNPTGANMITGIVSTFLKAPKAKTGEKKFAVLEIDEASLPK
ITEYIKPSLFVFTNIFRDQMDRYGEIYTTYDFIVKGAANSPKGTVLLNGDSPLFNSKKLV
NPVKYYGFNHESHEPTHAHYNTEGIVCPVCHHILAYKMNTYANLGNYICKNCGFSRPELD
YQLTELSEITNTSSKFVIDGTDYKINVGGLYNIYNALAAVSVAEYFNVPKETIAAGFELS
KAVFGRQETLEIDGKKVTIVLIKNPVGANQALEMMKLANYPFTLVSLLNANYADGIDTSW
IWDANFELINDMEIDQIITGGVRSSEMARRMRVTGFNAENISERKELSEVLEAIKESPKE
HVYILATYTAMLQMRELLAEGHYLGKEMR
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgacaataaaaacttcatttgcaaagtttgctggtaattcatcgcgctttgtcttggaa
aaatttttcaagcgcggttcaactttaccaggaaaaattgctttaaaatttgatcctgaa
attcttaaatcactgacaaaaaattatgaaatcattgttgtgactgggacaaatggaaaa
acattgaccacagcactgaccgtgggaattctagaaaaggcttttggaccggttgtgaca
aatccaactggggctaatatgataacggggattgtatccacatttttgaaagctcccaaa
gcgaaaactggcgaaaagaaatttgctgttcttgagattgatgaagcgagtttgccaaaa
atcactgaatatatcaaaccttcgttatttgtgtttactaatattttccgtgaccaaatg
gaccgctatggcgagatttatacaacttatgactttattgtcaagggtgcggcaaatagt
cctaaaggtacggttttgttaaatggcgatagtccacttttcaactcaaaaaaattagtt
aatcctgtaaaatactatggtttcaaccatgaaagccatgaacctactcatgctcattac
aatactgaggggattgtttgtcccgtttgtcatcatattttggcttacaagatgaatacc
tatgctaacttaggaaattatatctgtaaaaattgtggttttagtcgtccagagttagat
tatcaactgacagaattatcagagattacaaatacttcttctaaatttgtcatcgatggg
acagattataaaattaatgttggcggactttataatatttataatgctcttgctgctgta
tctgtcgctgaatatttcaatgtgccaaaagaaacaattgcggctggttttgaactttct
aaagcagtttttggtcgtcaagaaacgcttgaaattgacggaaaaaaagtaaccattgtt
ttgattaaaaatccagtaggtgctaatcaagcccttgaaatgatgaaattagccaattat
cctttcactttagttagccttttaaatgccaattatgctgacggaattgacacaagttgg
atttgggatgctaattttgaattaattaatgatatggaaattgaccaaattatcacaggt
ggtgttcgttcatctgaaatggctagaagaatgcgtgtgacaggttttaatgccgaaaat
atttctgaacgcaaggaactttcagaagttttagaggcaattaaagagagtccaaaagag
catgtttatattttggcaacttacactgcaatgttacaaatgcgtgaattattggctgag
ggtcattatcttggaaaggaaatgcgttaa

DBGET integrated database retrieval system