KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1159Help
Entry
LLKF_1159         CDS       T01141                                 

Gene name
tpiA
Definition
(GenBank) Triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00010  Glycolysis / Gluconeogenesis
llk00051  Fructose and mannose metabolism
llk00562  Inositol phosphate metabolism
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01120  Microbial metabolism in diverse environments
llk01130  Biosynthesis of antibiotics
llk01200  Carbon metabolism
llk01230  Biosynthesis of amino acids
Module
llk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
llk_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_1159 (tpiA)
   00051 Fructose and mannose metabolism
    LLKF_1159 (tpiA)
   00562 Inositol phosphate metabolism
    LLKF_1159 (tpiA)
Enzymes [BR:llk01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     LLKF_1159 (tpiA)
Exosome [BR:llk04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   LLKF_1159 (tpiA)
  Exosomal proteins of bladder cancer cells
   LLKF_1159 (tpiA)
  Exosomal proteins of melanoma cells
   LLKF_1159 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADA64860
UniProt: D2BQN5
Position
1174073..1174831
Genome map
AA seq 252 aa AA seqDB search
MSRKPIIAGNWKMNKTLSEAQAFVEAVKNNLPSSDNVESVIGAPALFLAPMAYLRQGSEL
KLAAENSYFENAGAFTGENSPAAIVDLGVEYIIIGHSERREYFHETDEDINKKAKAIFAA
GATPILCCGETLETFEAGKTAEWVSGQIEAGLAGLSAEQVSNLVIAYEPIWAIGTGKTAT
NEIADETCGVVRSTVEKLYGKEVSEAVRIQYGGSVKPETIEGLMAKENIDGALVGGASLE
ADSFLALLEMYK
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgtaaaccaattatcgctggtaactggaaaatgaacaaaactttgtcagaagcg
caagcttttgttgaagctgtaaaaaataacttgccttcatctgataatgttgaatcagtt
atcggtgcacctgcacttttcctcgctcctatggcttaccttcgtcaaggttcagaattg
aaacttgctgctgaaaatagctactttgaaaatgctggagcgttcactggtgaaaatagt
ccagctgctatcgttgatttaggtgttgaatacatcatcatcggtcacagcgaacgtcgt
gaatatttccacgaaactgacgaagacatcaacaaaaaagcaaaagcaatcttcgctgct
ggagcaactccaatcctttgttgtggtgaaactttggaaacttttgaagctggaaaaaca
gctgaatgggtttcaggtcaaatcgaagctggtcttgctggcttgagtgctgaacaagtt
tcaaacttggttattgcttatgaaccaatctgggcaatcggaactggtaaaactgcaaca
aacgaaatcgctgacgaaacttgtggtgttgttcgttcaacagttgaaaaactttacgga
aaagaagtttcagaagctgtacgtatccaatacggtggttcagttaaacctgaaacaatc
gaaggattgatggctaaagaaaacatcgacggtgccctcgttggtggagcttcacttgaa
gctgatagcttccttgcattgcttgaaatgtacaaataa

DBGET integrated database retrieval system