KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1175Help
Entry
LLKF_1175         CDS       T01141                                 

Gene name
dfrA
Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:llk00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:llk00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188690..1189196
Genome map
AA seq 168 aa AA seqDB search
MIIGIWAEDEAGLIGEADKMPWSLPAEQQHFKETTMNQVILMGRKTFEGMNKRVLPGRIS
IILTRDETYQSDNEKVLIMHSPKEVLDWYHKQNKDLFITGGAEILALFESELELLYRTVV
HEKFKGDTYFPSTFDFGKFKLVSEKLHDKDERNSYTFTIKKYEKVKQP
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgataattggaatatgggcagaagatgaagcaggtcttatcggtgaagctgataaaatg
ccttggtctttacctgctgaacaacaacattttaaagaaacaaccatgaatcaagtgatt
ttgatgggacgaaaaacatttgaaggaatgaataaacgtgtattgccagggagaataagt
attattttaactcgcgatgaaacttatcaatcagataatgaaaaagtgctcatcatgcac
agccctaaggaagttctagattggtaccataagcaaaataaagacttatttatcacagga
ggagctgaaattttagccctttttgaatctgaacttgaattgctctatcgaacagttgtt
catgaaaaatttaaaggagatacttattttccaagtacatttgactttgggaaatttaaa
ctagtctctgaaaaacttcacgataaagatgagcggaattcttatacttttacaattaaa
aaatatgaaaaagtgaaacaaccatga

DBGET integrated database retrieval system