KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1180Help
Entry
LLKF_1180         CDS       T01141                                 

Gene name
folKE
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase (EC:2.7.6.3 3.5.4.16)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:llk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1191742..1192791
Genome map
AA seq 349 aa AA seqDB search
MQTTYLSMGSNIGDRQYYLHEAIRLLGKHPKIMIEKVSNFYESTPVGGVKQDDFTNLALK
VATLLEPLELLSFIHEVELSLNRERKIHWGPRTIDIDIIFYDDLEMQEENLVIPHKEAFN
RLFVLKPIFELIDKDFKYYASIEKAIAELSVSEQELHVIKEEKTPRNRIEDAVKEILFAV
GEYPNREGLLETPARVAKMYEEILSSQRLSKFNEYKLFEIDSSKTDSIVLIKDIPFYSMC
EHHMLPFFGKAHVAYIPADGKIIGLSKIPRLVDYVSRKLSVQENITHDIGDILTDILNPK
GVAVLVEGRHMCVEMRGVKKVNSITKTSYFLGEFKENNEKRMEFLESLL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgcaaacaacttacttaagcatgggaagtaatattggtgaccgtcagtattatttacat
gaagccattcgtttattgggaaaacaccctaaaattatgattgaaaaagtatcaaatttt
tatgaaagtactccagtcggcggcgtcaaacaagatgattttactaatttggcattaaag
gtggcaacgctacttgaacctttggaattattatcttttattcatgaagttgagttatct
ttgaaccgtgagcgaaaaattcattgggggccaagaacaattgatattgatattattttc
tatgacgacttagaaatgcaagaagaaaacttggttattccacataaagaagcttttaat
cgtctttttgtcttgaaacctatttttgaacttattgataaagactttaaatattatgcg
tcaatagaaaaagcaatagccgaactttcagtaagtgaacaagagctccatgtaataaaa
gaagaaaaaacaccgagaaatcgtattgaagatgccgttaaagagattctctttgcagta
ggtgaatatccaaatcgagaaggattacttgaaactccagcgagagtagctaaaatgtat
gaagaaattctttcatcacaacgcttaagcaagtttaatgagtataaactttttgaaatt
gattcttctaaaacggattcaatcgtgttgattaaagatattcctttttattcaatgtgt
gagcatcatatgttaccattttttgggaaagctcatgttgcctatattccagctgatgga
aaaattattggcttgtcaaaaattccccgtttagttgattatgtttcgcgcaaactctcg
gttcaagaaaatatcactcatgatattggagatattttgactgatattttgaatcctaaa
ggagtggcagttcttgttgaaggacgtcatatgtgcgttgaaatgcgtggagtaaaaaaa
gtaaattctattactaaaacttcttattttttaggtgaatttaaagaaaataatgaaaaa
agaatggaatttttagaaagtcttttatga

DBGET integrated database retrieval system