KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1181Help
Entry
LLKF_1181         CDS       T01141                                 

Gene name
folP
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:llk00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1192788..1193861
Genome map
AA seq 357 aa AA seqDB search
MKILELNQESFSLKNIILKFDELNHNEMISLQKKLYRNGSLTRLAPDSLLVVLTIDDLAK
LINLFENDEDKKMLEVIYKRHQIIWSGKNFNFDLTRKSIVYSIVNVTPDSFYDGNPDNLN
LSHILKRVEADLENGASVLELGGKSSKPGYDDISPEEEWNRLKEPILELKKNFPKAIFAV
DTDEAYVMERVLDAGVDIINDIDGFDTNDKLKVVEKYQPALVAMNNGRAGFSYADNVYEE
LPLFFENKKEELLQLGLKAEQIVIDPGVGFFNGDSGSDSLERVKATEILSRIGLPLMIAI
SRKSFMGKLFNAQGDERLFSSLVLEAQMVADGGRILRVHDVKETKRLLDAIEIYKEF
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcttagaacttaatcaagaatctttttctcttaaaaatattatcctaaaattt
gatgagttaaatcacaatgaaatgatttctcttcaaaaaaaactttatcgaaatggtagt
ttgacaagactggctccagactccttgttagtagttttaacaattgatgacttagcaaaa
ttgattaatctttttgaaaatgatgaagataaaaaaatgcttgaagtgatttataagcgt
catcaaatcatttggtcaggtaaaaatttcaattttgatttaactagaaagtcaattgtc
tattcaatcgtcaatgttacaccagactctttttatgatggaaatccagataatttaaac
ctctctcatattttaaaaagagtagaagctgatttagaaaatggagcttctgttcttgag
ctgggagggaaatcatcgaaaccaggatatgacgatattagcccagaagaggaatggaac
agactgaaagaacctattcttgagttgaaaaaaaactttcctaaagcgatttttgctgtc
gatacggatgaagcttatgtcatggaacgagttttagacgctggggttgatattattaac
gatattgatggttttgatacaaatgataaattaaaagtggtagaaaagtatcaaccggct
ttagttgctatgaataatgggcgagctggttttagttatgctgataatgtttatgaagaa
cttccattattttttgaaaataaaaaagaagagttacttcaacttggtttaaaagctgaa
caaatcgttattgatcctggagttgggttttttaatggagattcaggttcagatagtctt
gagcgggttaaagcaactgaaattttaagcagaataggtttacctcttatgattgcaatc
tctcgtaagtcatttatgggaaaactcttcaatgcccaaggagatgagcggcttttttca
agccttgtcctagaagcgcaaatggttgctgacgggggacggattttgcgtgttcatgat
gttaaggagactaaacgtttactcgatgcaattgaaatttataaggaattttaa

DBGET integrated database retrieval system