KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1310Help
Entry
LLKF_1310         CDS       T01141                                 

Gene name
glpD
Definition
(GenBank) Alpha-glycerophosphate oxidase
  KO
K00105  alpha-glycerophosphate oxidase [EC:1.1.3.21]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00564  Glycerophospholipid metabolism
llk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    LLKF_1310 (glpD)
Enzymes [BR:llk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.21  glycerol-3-phosphate oxidase
     LLKF_1310 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 Pyr_redox_2 FAD_binding_3 Pyr_redox NAD_binding_8 FAD_oxidored 3HCDH_N GIDA
Motif
Other DBs
NCBI-ProteinID: ADA64988
UniProt: D2BR13
Position
complement(1357496..1359325)
Genome map
AA seq 609 aa AA seqDB search
MAFSKKTRQEAITKVQNEEMDLLIIGGGITGAGLALQAAATGMKVSVLEMQDFSEGTSSR
STKLVHGGIRYLKNFDVEVVSDTVSERAVVQSIAPHIPKPDPMLLPIYNDEGKTTFDMFS
VKIAMDLYDRLAGIDEGSPYANYTISPEEVLRREPLIKKKGLQGAGVYLDYRNNDSRLVI
DNIKKAVEDGAKAISKMKVIDFIYTDGQISGVRARDLLTDEVIEVKSKLVINTSGPWVDK
IRYLNFTRPIVPKMRPTKGVHLVVDAAKLPVPQPTYFDTGKHDKRMVFAIPRENKTYFGT
TDTDYHGDFTDPKVTQEDVDYLLDVINFRYPGANITINDIEASWAGLRPLLGGNSGSDYN
GGDNGAVSETSFNAVVEAVLRYKNKTATKAEVEHLLNNMESSLSEKGDAPSSVSRGSSLE
RESDGLITLAGGKITDYRKMAAGAMELICQLLVEDFDLKYEPIDSKKYQISGGEFDPTKV
EEVVAENMKIGVVAGLTEEEAKYIADFYGMNALQVFAYASEMKPYEGLSLAESARLRYAL
EDEMILTPVDYFLRRTNHILFMRESVDTIKVHVVNVIAGFLGWSVEEKAEQEKALEKALR
ESDLSDLKK
NT seq 1830 nt NT seq  +upstreamnt  +downstreamnt
atggctttttctaaaaaaacaagacaagaagcaatcacaaaagttcagaatgaagaaatg
gatttactcattatcggaggtggtattactggtgctggattggctttacaagcggcagcc
actggtatgaaagtttctgtgcttgaaatgcaggacttttcagaaggaacatcgtcacgt
tcaacgaaactcgtgcatgggggtatccgttatctaaaaaactttgatgtcgaagtcgtt
tccgacactgtttcagaacgtgctgttgttcaaagtattgcgccacatattcctaagcca
gacccgatgttacttcctatttacaatgatgaaggcaaaacgacttttgatatgttttct
gtgaaaatcgccatggatttgtatgatcggttggcaggtattgatgaaggttctccatat
gccaactataccatctcaccagaagaagtgctacgccgtgagccactgatcaagaaaaag
ggtttgcaaggtgcaggggtttatcttgactaccgtaacaacgattcacgtttggtgatt
gacaatattaaaaaagctgtagaagacggcgcaaaagccatcagcaagatgaaagtgatt
gattttatctatactgatgggcaaatctctggtgttcgggcgcgtgacttattgacagat
gaagtcattgaagtaaaatctaaacttgtgattaacacaagtggtccttgggtagataag
atacgttacttgaacttcactcgtccgattgtgccaaaaatgcgtccgacaaaaggtgtc
catcttgtggttgatgctgccaaattacctgtgcctcaaccaacatattttgatacagga
aaacatgataaacgtatggtttttgccattccacgtgaaaataaaacatattttggtacg
acagatacggattatcatggggactttaccgatccaaaggttactcaagaagatgtggac
taccttttagatgtcatcaatttccgttatcctggagcaaatatcacgattaatgacatt
gaagcttcatgggctggattgcgtccattgctaggtgggaattcgggttcagactataac
ggaggtgataacggtgcagtttctgaaactagctttaacgctgtcgtagaggccgtgctt
cgctataaaaataaaacagcaactaaagccgaagtagagcatttattgaacaatatggaa
tcaagtctttcagaaaaaggggacgcgccatcttcagtttctcgtgggagttcacttgaa
cgtgagagtgatggtttgattactttagctggtgggaaaatcactgactaccgtaaaatg
gcagcaggtgcgatggagcttatctgccagctgcttgttgaggactttgatttgaaatat
gaaccaatcgactctaaaaaataccagatctctggtggtgaatttgatccaactaaggtt
gaagaagtcgttgctgaaaatatgaaaatcggtgttgttgcaggtcttacagaagaggag
gcgaaatacatagcagacttttatggaatgaacgcgctccaagtatttgcctatgcttct
gaaatgaaaccttatgaaggcttatctttggcagaatcagcccgtctgcgttatgcgctt
gaggatgaaatgatcttgacaccggtagactacttccttcgtcgtactaaccatatttta
tttatgcgagaaagtgtagatacaatcaaagttcatgttgtcaacgtcattgcaggcttt
ctcggttggtctgtagaagaaaaagcagaacaagaaaaagctttggaaaaagcgcttcgt
gaatctgacttatcagatttgaagaaataa

DBGET integrated database retrieval system