KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1424Help
Entry
LLKF_1424         CDS       T01141                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00010  Glycolysis / Gluconeogenesis
llk00030  Pentose phosphate pathway
llk00051  Fructose and mannose metabolism
llk00052  Galactose metabolism
llk00680  Methane metabolism
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01120  Microbial metabolism in diverse environments
llk01130  Biosynthesis of antibiotics
llk01200  Carbon metabolism
llk01230  Biosynthesis of amino acids
llk03018  RNA degradation
Module
llk_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_1424 (pfkA)
   00030 Pentose phosphate pathway
    LLKF_1424 (pfkA)
   00051 Fructose and mannose metabolism
    LLKF_1424 (pfkA)
   00052 Galactose metabolism
    LLKF_1424 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LLKF_1424 (pfkA)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    LLKF_1424 (pfkA)
Enzymes [BR:llk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LLKF_1424 (pfkA)
Protein phosphatases and associated proteins [BR:llk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LLKF_1424 (pfkA)
Messenger RNA biogenesis [BR:llk03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     LLKF_1424 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ADA65095
UniProt: D2BRC0
Position
complement(1492192..1493214)
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccaggaatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagatattttcccgcttacgtcagcttcagttggtgataaa
atcggtcgtggtggtacattcttgtattcagcacgctacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgatggttcttatcatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggaacaatcgataacgatatcgtaggaactgattttacaattggatttgat
acagctgtttcaacagttgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatattgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacattaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggtgtaatgactggtgaagaatttgctacaaaacttaaagaagctgggtataaa
ggagatcttcgcgtttctgtccttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggtgctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaaca
gctgaagaaggagcactctttagtttgactactgaaggtggaatcaaagtaaataacccg
cataaagctggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system