KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1424Help
Entry
LLKF_1424         CDS       T01141                                 

Gene name
pfkA
Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLKF_1424 (pfkA)
   01230 Biosynthesis of amino acids
    LLKF_1424 (pfkA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_1424 (pfkA)
   00030 Pentose phosphate pathway
    LLKF_1424 (pfkA)
   00051 Fructose and mannose metabolism
    LLKF_1424 (pfkA)
   00052 Galactose metabolism
    LLKF_1424 (pfkA)
  Energy metabolism
   00680 Methane metabolism
    LLKF_1424 (pfkA)
Enzymes [BR:llk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     LLKF_1424 (pfkA)
Protein phosphatases and associated proteins [BR:llk01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     LLKF_1424 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1492192..1493214)
Genome map
AA seq 340 aa AA seqDB search
MKRIAVLTSGGDAPGMNAAIRAVVRKAISEGIEVYGINHGYAGMVAGDIFPLTSASVGDK
IGRGGTFLYSARYPEFAQVEGQLAGIEQLKKFGIEGVVVIGGDGSYHGAMRLTEHGFPAV
GLPGTIDNDIVGTDFTIGFDTAVSTVVDALDKIRDTSSSHNRTFVVEVMGRNAGDIALNA
GIAAGADDICIPEKEFKFENVVNNINKGYEKGKNHHIIVLAEGVMTGEEFATKLKEAGYK
GDLRVSVLGHIQRGGSPTARDRVLASRMGARAVELLRDGIGGVAVGIRNEELVESPILGT
AEEGALFSLTTEGGIKVNNPHKAGLELYRLNSALNNLNLN
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgcattgcagttttgacttctggtggtgatgccccaggaatgaatgcggctatt
cgtgcagttgttcgcaaagcaatttctgaaggtatcgaagtttacggtatcaatcacgga
tatgcgggcatggttgcgggagatattttcccgcttacgtcagcttcagttggtgataaa
atcggtcgtggtggtacattcttgtattcagcacgctacccagaatttgctcaagtagaa
ggacaacttgctgggattgagcaacttaaaaaattcggtatcgaaggtgtcgttgtaatc
ggtggtgatggttcttatcatggagctatgcgtcttacagaacatggtttcccagctgtt
ggacttccaggaacaatcgataacgatatcgtaggaactgattttacaattggatttgat
acagctgtttcaacagttgtagatgccttggataaaatccgtgatacttcatcatcacat
aaccgtactttcgttgtagaagtaatgggacgtaatgctggagatattgctttgaatgct
ggtatcgctgctggtgcagatgatatttgtattccagaaaaagaatttaagtttgaaaac
gtagttaacaacattaacaaaggctacgaaaaaggtaaaaatcaccacatcatcgttctt
gctgaaggtgtaatgactggtgaagaatttgctacaaaacttaaagaagctgggtataaa
ggagatcttcgcgtttctgtccttggacacatccaacgtggtggttcaccaacagctcgt
gaccgtgttcttgcttcacgtatgggtgctcgtgccgttgaattgcttcgtgatggaatc
ggtggcgtagccgttggtatccgtaatgaagaacttgtagaaagtccaattctcggaaca
gctgaagaaggagcactctttagtttgactactgaaggtggaatcaaagtaaataacccg
cataaagctggtcttgaactttaccgtcttaactcagcactcaacaatcttaaccttaac
taa

DBGET integrated database retrieval system