KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1566Help
Entry
LLKF_1566         CDS       T01141                                 

Gene name
trpA
Definition
(GenBank) Tryptophan synthase, alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00260  Glycine, serine and threonine metabolism
llk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01130  Biosynthesis of antibiotics
llk01230  Biosynthesis of amino acids
Module
llk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLKF_1566 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLKF_1566 (trpA)
Enzymes [BR:llk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LLKF_1566 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA His_biosynth
Motif
Other DBs
NCBI-ProteinID: ADA65228
UniProt: D2BKC2
Position
complement(1618271..1619032)
Genome map
AA seq 253 aa AA seqDB search
MKTLQMTLSNKKNNFIPYIMAGDHEKGLEGLKETIQLLEQAGSSAIEIGVPFSDPVADGP
VIEQAGLRALARNVSLSSILETLKTIDTKVPLVIMTYFNPVYQFGIEKFVAALEETPVKG
LIIPDLPKEHEDYIKPFINDKDICLVPLVSLTTPLSRQKELVADAEGFIYAVAINGVTGK
ENAYSNQLDQHLKALSSLTDIPVLTGFGVSTLSDVDRFNKVSSGVIVGSKIVRDLHEGKE
NEVIKFIENAINF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacaaatgactttaagcaataaaaaaaataattttattccttatatcatg
gctggcgaccatgaaaaaggcttagaaggtcttaaagaaaccattcaactgcttgaacaa
gccgggagctccgctattgaaattggcgttccattttcagatccggttgctgatggtcca
gtcatcgaacaagcaggtttgcgtgctttagcaagaaatgtatcactttcaagtattctt
gaaaccttaaaaacaattgatacaaaagttcctctagtaattatgacctatttcaatccc
gtttatcagtttggaattgaaaagtttgttgcagctcttgaagaaacaccagttaaaggc
cttatcattcctgatttgcctaaagagcatgaggactatatcaaaccctttatcaatgat
aaagatatctgtttagttcctctggtctcattaaccacgccactttctcggcaaaaagaa
cttgtagccgatgctgaaggatttatctatgccgttgcaataaatggagtaactgggaaa
gaaaatgcttatagtaaccagcttgaccaacatttaaaagcgttgtcttcattaacggat
attcctgttttgacaggatttggagtttctacattatctgatgtggaccgttttaataaa
gtgtcctcaggagttattgttggttcaaaaattgttcgtgatttacatgaaggtaaagaa
aacgaagttattaaatttattgaaaacgcaatcaatttttaa

DBGET integrated database retrieval system