KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1566Help
Entry
LLKF_1566         CDS       T01141                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LLKF_1566 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLKF_1566 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLKF_1566 (trpA)
Enzymes [BR:llk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LLKF_1566 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1618271..1619032)
Genome map
AA seq 253 aa AA seqDB search
MKTLQMTLSNKKNNFIPYIMAGDHEKGLEGLKETIQLLEQAGSSAIEIGVPFSDPVADGP
VIEQAGLRALARNVSLSSILETLKTIDTKVPLVIMTYFNPVYQFGIEKFVAALEETPVKG
LIIPDLPKEHEDYIKPFINDKDICLVPLVSLTTPLSRQKELVADAEGFIYAVAINGVTGK
ENAYSNQLDQHLKALSSLTDIPVLTGFGVSTLSDVDRFNKVSSGVIVGSKIVRDLHEGKE
NEVIKFIENAINF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacaaatgactttaagcaataaaaaaaataattttattccttatatcatg
gctggcgaccatgaaaaaggcttagaaggtcttaaagaaaccattcaactgcttgaacaa
gccgggagctccgctattgaaattggcgttccattttcagatccggttgctgatggtcca
gtcatcgaacaagcaggtttgcgtgctttagcaagaaatgtatcactttcaagtattctt
gaaaccttaaaaacaattgatacaaaagttcctctagtaattatgacctatttcaatccc
gtttatcagtttggaattgaaaagtttgttgcagctcttgaagaaacaccagttaaaggc
cttatcattcctgatttgcctaaagagcatgaggactatatcaaaccctttatcaatgat
aaagatatctgtttagttcctctggtctcattaaccacgccactttctcggcaaaaagaa
cttgtagccgatgctgaaggatttatctatgccgttgcaataaatggagtaactgggaaa
gaaaatgcttatagtaaccagcttgaccaacatttaaaagcgttgtcttcattaacggat
attcctgttttgacaggatttggagtttctacattatctgatgtggaccgttttaataaa
gtgtcctcaggagttattgttggttcaaaaattgttcgtgatttacatgaaggtaaagaa
aacgaagttattaaatttattgaaaacgcaatcaatttttaa

DBGET integrated database retrieval system