KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1567Help
Entry
LLKF_1567         CDS       T01141                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LLKF_1567 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLKF_1567 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLKF_1567 (trpB)
Enzymes [BR:llk01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     LLKF_1567 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1619029..1620237)
Genome map
AA seq 402 aa AA seqDB search
MTYNQPNNKGFYGQFGGQFVPETLMTAVKQLEEAYEDSKKDPLFQAELKELLKDYVGREN
PLYYAKRLTEYAGGAKIYLKREDLNHTGAHKINNALGQVLLAKKMGKNKVIAETGAGQHG
VATATAAALFGMECTIYMGEEDVKRQSLNVFRMELLGAKVHSVTDGSRVLKDAVNAALRA
WVAQVEDTHYVMGSVLGPHPFPQIVRDYQAVIGQEARAQFLEKENKLPDALVACVGGGSN
SMGLFYPFVNDESVAMYGVEAAGLGIDTPHHAATITKGRPGVLHGTLMDVLQDENGQILE
AFSISAGLDYPGIGPEHSYFNAVGRAKYVDITDEEALEGFKILSRTEGIIPALESSHAIA
YAVKLAKELGADKSMIVCLSGRGDKDVVQVKERLEAEKEVKK
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacctacaaccaacctaacaacaaaggattttacggccaattcgggggccaattcgta
cctgagacactaatgacagcagtaaaacaattagaagaagcctacgaagatagtaaaaaa
gaccctctctttcaagcagaacttaaagaattacttaaagactatgttggacgagaaaac
ccactctattatgcaaaacgcttaacagaatatgcgggcggagcaaaaatttatcttaaa
agagaagacctaaaccatacaggagcacacaaaattaacaatgccctcggacaagtcctc
cttgccaaaaaaatgggaaaaaataaagtcattgctgaaacaggggcaggccaacacggt
gtcgcaaccgcaaccgctgctgccctctttggcatggaatgtacgatttatatgggtgaa
gaagacgttaaaagacaatctctcaatgtctttcgcatggaattactcggggcaaaagtt
cattcagtaactgatggttcacgcgtacttaaagatgcggttaatgcagcacttagagca
tgggttgctcaagttgaagacacgcattatgtaatgggctcagttcttggaccacatcca
tttccacaaattgtgcgtgattatcaagctgttattggacaggaagcacgtgcccaattt
ttagaaaaggaaaataaacttccagatgctttagtagcttgtgttggcggaggctcaaat
tctatgggacttttttatcccttcgttaatgatgaatcagttgccatgtatggtgttgaa
gccgctggccttgggattgatacaccacatcatgcggcaacaattactaaaggccgcccc
ggtgttcttcacggaacactcatggatgtccttcaagatgaaaatggtcaaatcttagaa
gcctttagtatttcagccggtttagactatccaggaatcggaccagaacactcttatttc
aatgctgttggacgagcaaaatatgttgatattacagatgaagaagcacttgaaggtttt
aaaatcttatctagaactgaaggaattatcccagcactagagagttctcatgctatcgcc
tatgcagtcaaattagcaaaagaattaggagcagataaatcaatgattgtttgtctttca
ggacgtggagataaggatgtggttcaagttaaagaacgacttgaagcagaaaaagaggtg
aaaaaatga

DBGET integrated database retrieval system