KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1570Help
Entry
LLKF_1570         CDS       T01141                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
llk00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llk01100  Metabolic pathways
llk01110  Biosynthesis of secondary metabolites
llk01130  Biosynthesis of antibiotics
llk01230  Biosynthesis of amino acids
Module
llk_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    LLKF_1570 (trpC)
Enzymes [BR:llk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     LLKF_1570 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADA65232
UniProt: D2BKC6
Position
complement(1621867..1622661)
Genome map
AA seq 264 aa AA seqDB search
MNIKKGKFLETILAEKRLEIAKMPEEQVGKVRQTYNFYDYLKEHSDQLQVIAEVKKASPS
LGDINLEVDIVDQAKNYEQAGAAMISVLTDPVFFKGNIEYLREISENVQIPTLNKDFIID
KKQINRAVNAGATVILLIVAVFENQYPKLQNLYNYALSLGLEVLVETHNKAELEIAHQLG
AKIIGVNNRNLKTFEVSLQNSVDLTPYFKEDNIYISESGIFSANEAQKVSDAFNGILVGT
ALMQSENLEKSLKDLKVKRKTNEN
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaaaaaaggaaaatttctagaaacaatcctagcagaaaaacgacttgaaatt
gctaaaatgccagaagaacaagtaggaaaagttcgtcaaacatacaatttttatgattac
ttaaaagaacattccgaccagcttcaagtgattgccgaagtcaaaaaagcttcgcccagt
ctaggtgatattaatttagaagtggatatcgttgaccaagccaaaaattacgaacaagcc
ggtgccgctatgatttccgtcttaactgaccctgtattttttaaaggaaatattgaatat
ctccgtgaaatttcagaaaatgtccaaatcccaaccttgaacaaggattttatcatcgat
aaaaaacaaatcaatcgggcagttaatgcgggagcaacagttattttactcattgtcgca
gtttttgaaaatcaataccccaaactccaaaacctctacaactacgcactttcactagga
cttgaagttcttgttgaaacacataataaagcagaacttgagattgctcatcagcttggg
gctaaaattattggagttaataatcgtaatttaaaaacctttgaagtgagcttgcaaaat
tcagtagatttgactccctactttaaagaagacaatatctacatttccgaatcaggaatt
tttagcgcaaacgaagcccaaaaagtttccgatgctttcaatggaatattggttggaaca
gcactcatgcaatcagaaaatctagaaaaatctttgaaagatttaaaagtcaagaggaaa
acgaatgaaaattaa

DBGET integrated database retrieval system