KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1607Help
Entry
LLKF_1607         CDS       T01141                                 

Gene name
lnbA
Definition
lacto-N-biosidase (EC:3.2.1.140)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:llk00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:llk00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1660090..1661067)
Genome map
AA seq 325 aa AA seqDB search
MEKGLLVDIGRKYWSIAELKRLVLLLQEHKLTHLQLHLNENEGFALNFTDSPVSKKYSEN
MLKELKEFAKTHEITLIPDFDSPGHMGSLLEQNPEFALPNSKQQAVDVTNPAVIDWIIGI
IDKIVDIFPDSDTFHIGADEFIDFRQIEKYPYLVEKTREKYGNRASGLEFYYDYVNQLIE
HLQKKGKQVRIWNDGFLRKDLQSLVPLNKNVEVCYWTNWDKGMAEVKEWLTKGYTLINFC
DNDLYYVLGEEAGYSYPTAEKLEREGKIQKFSGQQYLNQEEMKAVRGTYFSIWADNAAAK
SVSEILDDLSKVLPVFMKIYGGNDE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaggattattagtcgatattggacgaaaatattggtcaatagcagagttaaaa
agattagttcttttacttcaagagcataagctgactcatttacaacttcatctcaatgaa
aatgaaggatttgcgctaaattttactgacagccctgtcagtaaaaaatattcagaaaat
atgctcaaagaattgaaagaatttgcaaaaacacacgaaatcactttgattcctgatttt
gatagtccaggtcacatgggctccttgttagagcaaaatcctgaatttgcactacctaac
agcaagcaacaagcggtagatgttactaatccagcagtcattgattggattatcggaata
attgataagatagtcgatattttcccagattcagatacttttcatatcggggctgatgaa
tttattgattttcggcaaattgaaaaatatccttatttagtggagaaaactcgggaaaaa
tatggaaatagggcaagtggtttagagttttattatgactatgttaatcaattgatcgag
catttgcagaaaaaaggaaaacaagttcgtatttggaatgatggatttttacgaaaagac
cttcagtcattggttcctttgaataaaaatgtggaggtttgttattggacaaactgggac
aaggggatggcagaagtcaaagaatggttaactaagggttataccttaataaatttttgt
gataatgacctttattatgttttaggtgaagaagcaggctattcttatccaacggctgaa
aaactggaaagggaaggaaaaattcaaaaattttctggtcagcaatatttaaatcaagaa
gagatgaaagctgtcagaggaacttacttttcgatttgggctgacaatgctgcagctaag
tctgtcagtgaaattttagacgatcttagcaaggtacttccggtatttatgaaaatttat
ggaggaaatgatgaataa

DBGET integrated database retrieval system