KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1671Help
Entry
LLKF_1671         CDS       T01141                                 

Gene name
ypjA
Definition
zinc-binding alcohol dehydrogenase (EC:1.1.1.-)
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LLKF_1671 (ypjA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_1671 (ypjA)
  Lipid metabolism
   00071 Fatty acid degradation
    LLKF_1671 (ypjA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LLKF_1671 (ypjA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LLKF_1671 (ypjA)
   00626 Naphthalene degradation
    LLKF_1671 (ypjA)
Enzymes [BR:llk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LLKF_1671 (ypjA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1730836..1731882)
Genome map
AA seq 348 aa AA seqDB search
MKSAYFVEKNKMEVREFPKAQLVKETDAIIKIVRACVCGSDLWWFRGISERQPGPVGHEA
IGLIEEVGTGVKNFKVGDFVIVPFTHGCGHCPICLAGFEANCPNAKDGVNGGYQGEFYRA
INADGALVKIPGQPSDYSDDQLASLTALADVMPTGFHAAKAADVHEGDTVVVFGDGAVGL
CAVISAKLLGAKRIIAMSRHEDRAALARDFGATDIIAERGEEAIQKIMFLTNGYGADAAL
ECVGTKQAIESAFQAVRAGGRVGRVGVPHDVDYNEWIDSLFWKNIQLGGGVASVARWDKE
ILLEAVLSGEINPGRVFTAEFSLDEIQKAYEAMDQRTAIKSLLRISEG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcagcttattttgtcgaaaaaaataaaatggaagttagagaatttcccaaagcg
caacttgtaaaagaaacagatgctatcataaaaattgttcgtgcctgcgtatgtggttcc
gatttatggtggttccgtgggatttctgaacgtcaacctggaccggtagggcatgaagct
attggtctgattgaagaagtaggcaccggagttaaaaactttaaagtaggagattttgtc
attgttccctttacgcacggttgtggacactgtccaatttgtttggctggctttgaagcc
aattgtccaaatgcaaaagacggtgtgaatggcggctatcaaggagaattctatcgggcg
attaatgctgatggtgcacttgtcaaaatcccgggccaaccaagtgattattctgatgac
cagttggcttcattgacggctttagctgatgtcatgcctacaggttttcatgcagctaaa
gcagcagatgtccatgaaggtgatacagtggttgtctttggtgatggagcggttggactt
tgtgcagtgatttcagctaaacttttaggagcaaaacggattattgccatgagtcgccat
gaagaccgtgcagcacttgcgcgtgactttggtgcaacagatattattgctgaacgtggt
gaagaagcgattcaaaaaataatgttcttaaccaatggttatggtgcagatgctgcctta
gaatgtgtcggaacaaaacaagcaattgaatctgcttttcaagcggtaagagcaggaggg
cgagtaggtcgtgtgggagttcctcatgatgttgattacaatgaatggattgattctctt
ttttggaaaaatattcaacttggagggggagtagcctctgtcgcacgctgggataaggaa
atcttacttgaagcagttttaagtggggagattaatccaggccgtgtctttacagcagaa
tttagcttagatgaaattcaaaaagcatatgaagcaatggatcaacgtacagcaattaaa
tctctattgagaatttcagagggataa

DBGET integrated database retrieval system