KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1695Help
Entry
LLKF_1695         CDS       T01141                                 

Gene name
thiL
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    LLKF_1695 (thiL)
   00630 Glyoxylate and dicarboxylate metabolism
    LLKF_1695 (thiL)
   00640 Propanoate metabolism
    LLKF_1695 (thiL)
   00650 Butanoate metabolism
    LLKF_1695 (thiL)
  Lipid metabolism
   00071 Fatty acid degradation
    LLKF_1695 (thiL)
   00072 Synthesis and degradation of ketone bodies
    LLKF_1695 (thiL)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LLKF_1695 (thiL)
   00310 Lysine degradation
    LLKF_1695 (thiL)
   00380 Tryptophan metabolism
    LLKF_1695 (thiL)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    LLKF_1695 (thiL)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    LLKF_1695 (thiL)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    LLKF_1695 (thiL)
Enzymes [BR:llk01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     LLKF_1695 (thiL)
Exosome [BR:llk04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LLKF_1695 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1752305..1753465)
Genome map
AA seq 386 aa AA seqDB search
MAFGGSFVKEIVIIDALRTPVGRYDGALAEYSAAELGTHVVSNLLSKHENIKSDVEQVIF
GNVLQAGNGQNIARQIAIHSGLSNTVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAG
GTESMSNAPIIKNRKTQEETLSMLNDGLVDAFSGISMGIIGETIAEQFDISRADQDAFAQ
NSQEKAVAASQAGIFKEEIVAIGEVGVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSP
VNDGASAVILATKDYAEKHGISYLAELVDSTEVGIDPAIMGVSPIEAIKKLINRSELELS
DIDLFEINEAFAASSLAVNRELGLNESQVNIYGGAIALGHAIGSSGSKILTTLSYALKRE
QKRYGIASLCIGGGLGLAVLLKNPNL
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atggctttcggaggttcattcgtgaaagaaattgtaatcattgacgccttaagaacacca
gttggaagatacgacggtgctcttgctgaatattcagcagcagaacttggaacacatgtt
gtttcaaacttattgtcaaaacatgaaaatataaaatcagatgttgaacaagttattttt
ggaaatgttcttcaagctggtaatggtcaaaatatagcacgtcaaattgcgattcatagt
ggtctatctaatacagtgcccgcttcaacaatcaacgaagtttgtggttcaggaatgaaa
gcagtgattttagctaaacaacttttacagcttggtgaagcagaagttgtaatcgctggt
gggacagaatctatgtctaatgccccaattataaagaatcgaaaaactcaagaagaaaca
ttaagtatgttaaatgatggcttagttgatgccttctcaggaatttctatggggattatt
ggtgaaactattgctgaacaatttgatataagtcgagcagaccaagacgcttttgcgcaa
aactctcaagaaaaagcggtcgctgcaagtcaagccggaatttttaaagaagagattgtt
gcgattggagaagtcggagtcgacgaaacaccacgtccttcttctagtttagaaaaatta
gccactttaaggacagctttcaaagaaaatggaactgtgacagcaggtaattcttctcct
gttaatgatggagcttcagctgtcattcttgcaacgaaagactatgctgaaaaacatggg
atttcgtacctagcagaactagttgatagtacagaagttggaattgaccctgctattatg
ggagtttcaccaattgaagctatcaaaaaattaattaatcgttcagagcttgaactttca
gatattgacctgtttgaaattaatgaagcatttgcagcatcaagtcttgctgtcaatcgt
gaacttggtttaaatgaatcacaagttaacatttatggtggtgcaattgcattaggtcat
gctatcggttcaagtggttctaaaattctcacgactttgtcttatgccttaaaacgtgag
caaaaacgctatggaattgctagtctttgtatcggtggaggcctaggtttggctgttctt
ttaaaaaatcctaacctttaa

DBGET integrated database retrieval system