KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1885Help
Entry
LLKF_1885         CDS       T01141                                 

Gene name
yrgI
Definition
(RefSeq) phosphoglycerate mutase family protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    LLKF_1885 (yrgI)
   01230 Biosynthesis of amino acids
    LLKF_1885 (yrgI)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_1885 (yrgI)
  Energy metabolism
   00680 Methane metabolism
    LLKF_1885 (yrgI)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LLKF_1885 (yrgI)
Enzymes [BR:llk01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LLKF_1885 (yrgI)
Exosome [BR:llk04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LLKF_1885 (yrgI)
  Exosomal proteins of melanoma cells
   LLKF_1885 (yrgI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1946596..1947165
Genome map
AA seq 189 aa AA seqDB search
MTEVYFIRHSLRDNAAYDDMDVPLTAEGEKRALILADAFANVSIEQIFSSPFQRSVRTLN
PLAHSKNLEIQLISDFRERNVGHEIADFWPFAKRQWNDFDYKFADGESLREVQNRNISAL
EQILTNSKNQKVAIGTHGTSLSTILNFYQPDFQFQDFQSLAGKMPYVIKMDFAENKYLTH
QVIEIDYEQ
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgactgaagtttattttattcgacattctcttagagataatgcagcctatgacgatatg
gatgttccactgactgccgagggtgaaaaacgcgcacttatcttggccgatgcttttgca
aatgtatcaatcgagcaaattttttccagtccatttcaacgttctgttcgtaccctgaat
cctcttgctcactctaaaaatcttgaaattcaactcatttctgattttagagaaagaaat
gttggccatgaaatagctgatttttggccctttgctaagcgacaatggaatgattttgat
tataaatttgctgacggagaatcattacgtgaagttcaaaatcgtaatatttcagccctt
gaacagattttaacaaattctaaaaatcaaaaagttgcaatcggaacacatggtacttct
ctttctaccattttaaatttttatcaaccagactttcagtttcaagattttcaatcttta
gctggaaagatgccctatgtcatcaaaatggactttgctgaaaataaatatctgacccac
caagtcattgaaattgattatgagcaataa

DBGET integrated database retrieval system