KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_1911Help
Entry
LLKF_1911         CDS       T01141                                 

Gene name
recD
Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:llk00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    LLKF_1911 (recD)
Enzymes [BR:llk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     LLKF_1911 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1974011..1976515)
Genome map
AA seq 834 aa AA seqDB search
MIEKTYFTGSIEAIFFSNPSNFYKVLLIEIDETNAEYDDFEIVVNGTIGDVVEGDSYTFY
GQLTQHPKYGEQLQVSQYEKAVPTSGAGLVKYFSSDKFPGIGKKTAEKIVETFPENTVDS
ILEAPEKLDGLLTLARKNSFIKRLRENHGMEKVLTKLAEYGLPSKITFQIYELYKEETIE
KIEENPYQLVEDVKGVGFKTADKIASSLGIEADSPNRFRAALMHEVNTHSQSTGDTYIEA
KNLLEMTIDLLEEARNVEVNPSAVAEEINGLIVDGKVQQEGTKIFENSLYFAEDGIRKSL
TALTNRSGKDFADEKLLTVLAEVERDLEITYDDLQKQAIIGAMNQQFFILTGGPGTGKTT
IINGFIETYARLHQLDLDPDHYNDDVFPILLAAPTGRASRRMNELTGLPAATIHRHLGLG
QDEAEDALGNELSGALLIVDEFSMVDTWLANKLFQAIPGSMKVLLVGDADQLPSVGPGQI
FADLLKIPEIPSVKLDKIFRQGDDSTITDLAHHIKDGQLPSDFTAKKPDRSYFEVSANFV
PQMVEQIASAWQKRGNNPFELQILAPMYKGMAGINAMNVLLQNLFNPLNDRLEFALGDMK
FREGDKVLHLVNDAEANVFNGDLGQIVELIAAKYTDSKQDELVMDFDGQELTYPRAEWYK
ITLAYAMSIHKSQGSEFSTVIVPMVSSYSRMLERNLLYTAITRAKQSLILLGEERAFAQA
VAREGANRKTYLIERFMGENPAAKNLSVEIVSEKVTDKKEISDKEKKPAAPVELQGQIRS
VSKKMPAQVEEISLFEDEEIETLDKGSLTEALILSGNFDPLIGLTQQDFAIFNK
NT seq 2505 nt NT seq  +upstreamnt  +downstreamnt
atgattgaaaaaacttattttactggttcgattgaggcaatatttttctccaatcccagt
aatttttataaagttctactcattgaaattgatgaaactaatgctgaatatgatgatttt
gaaattgtggttaacgggacaattggggatgtggttgaaggagattcttatacattttat
ggtcaattgacgcagcatcctaaatatggggaacaattacaggtcagtcaatatgaaaaa
gcagtgccgacttctggtgctggtttagttaaatatttttcttcagataaatttcctgga
attggtaagaaaacggcagaaaaaattgttgaaacttttcctgaaaatacggtagattca
attttagaagcgccggaaaaattggatggtctattgaccctagccagaaaaaattcattt
atcaaacgattacgtgagaatcatggaatggaaaaagtgctgaccaagcttgcagaatat
ggcttaccaagcaaaatcacttttcaaatttatgaactttataaagaagaaacgattgaa
aaaattgaggaaaatccttatcagcttgtggaagatgttaagggagttggttttaaaaca
gctgataagattgcaagtagtttaggaattgaagcggatagtcctaatcgatttcgagcg
gcattgatgcatgaggtcaatacacattcgcaatcaacaggcgatacttacattgaagcc
aaaaatttacttgagatgacgatagacttacttgaagaagctcgtaatgtcgaggtcaac
ccgtctgctgttgcggaggaaattaatggtttaatagttgatggaaaagtgcaacaagaa
ggaacaaaaatatttgagaattccttgtacttcgctgaggacgggattcggaaatcactg
acagcattaactaatcgttcgggtaaagattttgctgatgaaaagttactgacagtattg
gctgaagttgaaagagatttagaaattacttatgatgatttgcaaaagcaagccattatt
ggtgcaatgaatcagcaatttttcattttgactggtggaccaggaactggtaaaacaaca
attattaatggttttattgaaacttatgcccgtcttcatcagctagatttggacccagac
cattataatgatgacgtctttcctatattactggcagcaccgactggtcgagcttcaaga
cggatgaatgagttgactggtcttccagcagcgacgattcaccgtcatttgggtttggga
caagatgaagcagaagatgctcttggaaatgaattgtctggtgctcttttgattgttgac
gaattttctatggttgatacttggttagctaataaactttttcaagcgattcctggttca
atgaaagttctccttgttggagatgctgaccagcttccttctgtggggccaggacaaatt
tttgcggatttactaaaaattccagaaattccgtcagtaaaattggataagatttttcgt
caaggggatgattctaccattactgatttagctcaccacatcaaagatgggcaattgcca
agtgatttcacggcgaaaaaacctgaccgttcttattttgaggtcagtgctaattttgtt
cctcagatggttgaacaaatcgcaagtgcatggcaaaaaagagggaataatccttttgaa
ttacaaatcttagcgcctatgtataaaggaatggccggaattaatgcaatgaatgttctt
ttgcaaaatctctttaatccgcttaatgaccgacttgaatttgctttgggtgatatgaaa
tttcgtgaaggagataaagttcttcatttagtaaatgatgctgaggccaatgtatttaac
ggagatttgggacaaatcgtagaattgattgcagcaaaatatactgacagtaaacaagat
gagttggtgatggattttgatggtcaagaattgacttatccaagagcggagtggtataaa
attactctggcttatgctatgtccattcataaatctcaaggttcggagttttccacagtt
attgtgccgatggtttcttcgtattcacggatgttagagcgaaatttgctttatacggca
attacaagggctaaacaaagtctgattttacttggtgaagaacgagcttttgcacaagcg
gtggcgcgtgaaggggcgaatcgaaagacctatctgattgagcgatttatgggagaaaat
ccagcggctaaaaatctgtcagtagaaattgtgagtgaaaaagttactgacaaaaaagaa
atatctgacaaagagaagaagcctgcagcgccagtagaattacaagggcaaattcgttct
gtcagtaaaaaaatgccagcacaagtagaagaaatttctttatttgaagatgaagaaatt
gaaacactggataagggaagcttgacagaagcacttattttgtcaggaaattttgaccct
ttaattggtttaactcaacaagactttgcaatctttaataaataa

DBGET integrated database retrieval system