KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_2259Help
Entry
LLKF_2259         CDS       T01141                                 

Gene name
sucP
Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LLKF_2259 (sucP)
Enzymes [BR:llk01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     LLKF_2259 (sucP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2317224..2318669)
Genome map
AA seq 481 aa AA seqDB search
MPIQNKVMLITYADSLGKNLKDLQKILAEDLEGAVGGVHLLPFFPSTGDRGFAPQDYRQV
DSAFGDWADIEAIGERYYLMFDFMINHLSRQSPEFIDFKAKKEDSDFANLFLRNQNFWPE
NRPTQADIDLIYKRKDKAPFQEVTFADGTTELVWNTFGEEQIDLDVNQAVTRRFIKETLE
QLIDHGCDIVRLDAFAYAIKKLDTNDFFVEPEIWDLLNDVRDITIAKGCEILPEIHEHYS
IQHKIADHNFYIYDFALPMVSLYTLYSGQTKQLAKWLKMSPMKQFTTLDTHDGIGVVDAK
DILTDEETLYTSEQLYKVGANVKKIFSSEAYNNLDIYQINSTYYSALGDNDDAYLLARAF
QVFAPGIPQVYYVGLLAGKNDLDLLESSKEGRNINRHYYDVEEVKTELKRPVVQKLLNLL
TFRNTAQAFDLDGGIEIVTPSDNEIVITRFDAAKENVAVLTANAKTYAFEITLNDEKITL
L
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgcctattcaaaataaagtcatgttaattacttacgcagatagccttggtaaaaatcta
aaggacctccagaaaatcctagccgaagatttggaaggtgcagtgggaggtgtccattta
ctgccattctttccatccacaggtgaccgtgggttcgcaccgcaagattatcggcaagta
gacagcgcttttggtgattgggcagatatcgaagccattggcgagcgttattacttgatg
tttgactttatgatcaatcatttgtcgcgtcagagtccagaatttattgatttcaaggct
aagaaagaggattctgactttgctaatctctttttacgcaatcaaaatttttggccagaa
aatcgaccaacccaggcagacatcgatctcatttacaaacgtaaagacaaagcacccttt
caagaagtgacctttgcggatgggacgactgaattagtctggaacacctttggggaagag
cagattgacttagatgtcaatcaagccgtcacacgtcgcttcatcaaagagactttagag
caattgattgaccatgggtgtgacattgttcgactagatgcctttgcttatgcgattaag
aaattagacaccaatgatttctttgtggagccagaaatctgggacttgttaaacgatgtc
agagacatcacgatagccaaaggctgtgaaatcctaccagaaatccatgaacactacagc
atccaacataaaattgctgatcataatttttatatctatgattttgccttgccaatggtt
agtctttatacactctactctggtcaaaccaagcaattggccaaatggttaaagatgtct
cctatgaagcagtttacaacccttgatacccatgatgggattggtgttgttgatgctaag
gatattcttactgatgaagaaaccctgtatacttctgagcaactctataaggtcggtgct
aacgtcaagaaaatattctcatcggaagcctataataatctggatatttatcaaattaat
tcgacttactattcagctttaggtgacaatgatgatgcttacttgttagcacgtgctttc
caagtctttgcacctggcattcctcaagtgtactacgttggcctattagcagggaaaaac
gatctagacttacttgagtcttcaaaggaaggccgtaatattaaccgccattattatgat
gtcgaggaagttaaaacagaactcaaacgtccggtcgttcaaaaattactgaatctgttg
acattccgtaacacagcgcaggcttttgaccttgatggcgggattgaaattgtgacaccg
agtgacaatgagattgtgattacgcgctttgatgcagccaaagaaaatgttgccgtctta
accgccaatgctaaaacttacgctttcgagatcactctcaatgacgaaaaaatcacactt
ttatga

DBGET integrated database retrieval system