KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_2398Help
Entry
LLKF_2398         CDS       T01141                                 

Gene name
adhE
Definition
alcohol dehydrogenase (EC:1.1.1.1 1.2.1.10)
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LLKF_2398 (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LLKF_2398 (adhE)
   00620 Pyruvate metabolism
    LLKF_2398 (adhE)
   00650 Butanoate metabolism
    LLKF_2398 (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    LLKF_2398 (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LLKF_2398 (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LLKF_2398 (adhE)
   00626 Naphthalene degradation
    LLKF_2398 (adhE)
Enzymes [BR:llk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LLKF_2398 (adhE)
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     LLKF_2398 (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2452619..2455330
Genome map
AA seq 903 aa AA seqDB search
MATKKAAPAAKKVLSAEEKAAKFQEAVAYTDKLVKKAQAAVLKFEGYTQTQVDTIVAAMA
LAASKHSLELAHEAVNETGRGVVEDKDTKNHFASESVYNAIKNDKTVGVISENKVAGSVE
IASPLGVLAGIVPTTNPTSTAIFKSLLTAKTRNSIVFAFHPQAQKCSSHAAKIVYDAAIE
AGAPEDFIQWIEVPSLDMTTALIQNRGLATILATGGPGMVNAALKSGNPSLGVGAGNGAV
YVDATANIERAVEDLLLSKRFDNGMICATENSAVIDASVYDEFIAKMQEQGAYMVPKKDY
KAIESFVFVERAGEGFGVTGPVAGRSGQWIAEQAGVKVPKDKDVLLFELDKKNIGEALSS
EKLSPLLSIYKAETREEGIEIVRSLLAYQGAGHNAAIQIGAMDDPFVKEYGEKVEASRIL
VNQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLSTYDLLNVKTVAKRRNRPQWVR
LPKEIYYEKNAISYLQELPHVHKAFIVADPGMVKFGFVDKVLEQLAIRPTQVETSIYGSV
QPDPTLSEAIAIARQMKQFEPDTVICLGGGSALDAGKIGRLIYEYDARGEADLSDDASLK
ELFQELAQKFVDIRKRIIKFYHPHKAQMVAIPTTSGTGSEVTPFAVITDDETHVKYPLAD
YQLTPQVAIVDPEFVMTVPKRTVSWSGIDAMSHALESYVSVMSSDYTKPISLQAIKLIFE
NLTESYHYDPAHPTKEGQKARENMHNAATLAGMAFANAFLGINHSLAHKIGGEFGLPHGL
AIAIAMPHVIKFNAVTGNVKRTPYPRYETYRAQEDYAEISRFMGFAGKDDSDEKAVQALV
AELKKLTDSIDINITLSGNGVDKAHLERELDKLADLVYDDQCTPANPRQPRIDEIKQLLL
DQY
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcaactaaaaaagccgctccagctgcaaagaaagttttaagcgctgaagaaaaagcc
gcaaaattccaagaagctgttgcttatactgacaaattagtcaaaaaagcacaagctgct
gttcttaaatttgaaggatatacacaaactcaagtcgatactattgtcgctgcaatggct
cttgcagcaagcaaacattctctagaactcgctcatgaagccgttaacgaaactggtcgt
ggtgttgtcgaagacaaagataccaaaaaccactttgcttctgaatctgtttataacgca
attaaaaatgacaaaactgttggtgtcatttctgaaaacaaggttgctggatctgttgaa
atcgcaagccctctcggtgtacttgctggtatcgttccaacaactaatccaacatcaaca
gcaatctttaaatctttattgactgcaaaaacacgtaattctattgttttcgctttccac
cctcaagctcaaaaatgttcaagccatgcagcaaaaattgtttacgatgctgcaattgaa
gctggtgcaccggaagactttattcaatggattgaagtaccaagccttgacatgactacc
gccttgattcaaaaccgtggacttgcaacaatccttgcaactggtggcccaggaatggta
aacgccgcactcaaatctggtaacccttcactcggtgttggagctggtaatggtgctgtt
tatgttgatgcaactgcaaatattgaacgtgccgttgaagaccttttgctttcaaaacgt
tttgataatgggatgatttgtgccactgaaaattcagctgttattgatgcttcagtttat
gatgaatttattgctaaaatgcaagaacaaggcgcttatatggttcctaaaaaagactac
aaagctattgaaagtttcgtttttgttgaacgtgctggtgaaggctttggagtaactggt
cctgttgccggtcgttctggtcaatggattgctgaacaagctggtgtcaaagttcctaaa
gataaagatgtccttctttttgaacttgataagaaaaatattggtgaagcactttcttct
gaaaaactttctcctttgctttcaatctacaaagctgaaacacgtgaagaaggaattgag
attgtacgtagcttacttgcttatcaaggtgctggacataatgctgcaattcaaatcggt
gcaatggatgatccattcgttaaagaatatggcgaaaaagttgaagcttctcgtatcctc
gttaaccaaccagattctattggtggggtcggagatatctatactgatgcaatgcgtcca
tcacttacacttggaactggttcatgggggaaaaattcactttcacacaatttgagtaca
tacgatctattgaatgttaaaacagtggctaaacgtcgtaatcgcccacaatgggttcgt
ttgccaaaagaaatttactacgaaaaaaatgcaatttcttacttacaagaattgccacac
gtccacaaagctttcattgttgctgaccctggtatggttaaatttggtttcgttgataaa
gttttggaacaacttgctatccgcccaactcaagttgaaacaagcatttatggctctgtt
caacctgacccaactttgagcgaagctattgcaatcgcgcgtcaaatgaaacaatttgaa
cctgacactgtcatctgtcttggtggtggttctgctcttgatgctggtaagattggtcgt
ttgatttatgaatatgatgctcgtggtgaagctgacctttctgatgatgcaagtttgaaa
gaacttttccaagaattagctcaaaaatttgtcgatattcgtaaacgtattattaaattc
taccatccacataaagcacaaatggttgcaattcctactacttctggtactggttctgaa
gtgactccatttgcagttatcactgatgatgaaactcatgttaagtacccacttgctgac
taccaattaacaccacaagttgccattgttgaccctgagtttgttatgactgtaccaaaa
cgtactgtttcttggtctggtattgatgcgatgtcacacgcgcttgaatcttatgtttct
gttatgtcttctgactatacaaaaccaatttcacttcaagcgatcaaactcatctttgaa
aacttgactgagtcttatcattatgacccagcgcatccaactaaagaaggacaaaaagcc
cgcgaaaacatgcacaatgctgcaacactcgctggtatggccttcgctaatgctttcctt
ggaattaaccactcacttgctcataaaattggtggtgaatttggacttcctcatggtctt
gccatcgccattgctatgccacatgtcattaaatttaacgctgtaacaggaaacgttaaa
cgtaccccttacccacgttatgaaacatatcgtgctcaagaggactacgctgaaatttca
cgcttcatgggatttgctggtaaagatgattcagatgaaaaagctgtgcaagctctggtt
gctgaacttaagaaactgactgatagcattgatattaatatcaccctttcaggaaatggt
gtcgataaagctcaccttgaacgtgaacttgataaattggctgaccttgtttatgatgat
caatgtactcctgctaatcctcgtcaaccaagaattgatgagattaaacaactcttgtta
gaccaatactaa

DBGET integrated database retrieval system