KEGG   Lactococcus lactis subsp. lactis KF147: LLKF_2495Help
Entry
LLKF_2495         CDS       T01141                                 

Gene name
asnH
Definition
asparagine synthetase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
llk  Lactococcus lactis subsp. lactis KF147
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llk00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LLKF_2495 (asnH)
Enzymes [BR:llk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     LLKF_2495 (asnH)
Peptidases [BR:llk01002]
 Cysteine Peptidases
  Family C44
   LLKF_2495 (asnH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2544859..2546736)
Genome map
AA seq 625 aa AA seqDB search
MCGIVGFIDRMNQNDKSKTLEEMMNTIVHRGPSSSGEFIDEGAAIGFRRLSIIDLEGGDQ
PIFNEDKSKLITFNGEIYNFRELREDLISKGHDFTTHADTEVLLHGYEEYGVELLQKLRG
MFAFVIWDREKQELFGARDHFGIKPLYYTQMGGTFMYGSEIKSFLKHPNFKKELNKEALK
PYMTFQYSALDETFFKNVFRIKEGHYFTYKDGVLDIKPYWDMKVDEKDMSLEESIDLIDK
TVLGSVDAHKFADVEVGAFVSSGVDSSYVASTLRPEHTYSIGFGQGTFNESKQAKQLTDM
IGLNNTSREIHGDEAFKYFPQIQYYLDEPDSNPSCVPLFFLAELAARDVRVVMSGEGADE
LFAGYESYGFSTNSRAVRVFAEGLKKLPKSLRFSIARGIENKHFKGQKHLYESLAPAEDF
FIGQAKVFDESESVELLKEEFKVAPNVKDIVGKTYKKAPEGSELRKMQYLDMHQWMPGDI
LLKADKMAMAHSLELRVPLLDIELMHTAEQIPTKYLLNEHNTKYAFRQAARRHLPEEWSN
RKKLGFPVPIKDWLREEKYYKVVRQLFEQDFVAEFFDQEKLLKMLDDNFADKNDARRKLW
TIYSFLTWYDVYFINNGEKPAVVNF
NT seq 1878 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgtcggctttattgaccggatgaatcaaaatgataaatcaaaaacttta
gaagaaatgatgaatactattgttcaccgtggtccaagtagttcaggtgaatttattgat
gaaggtgctgcaattggttttcgtcgtttgagtattattgaccttgaaggtggagatcaa
cccattttcaatgaagataaaagtaaattgattacttttaatggtgaaatttataacttc
cgcgaattacgtgaggaccttatctctaaaggtcatgattttacaactcatgctgataca
gaagttcttttgcatggttatgaagaatatggtgtagaacttcttcaaaagcttcgtgga
atgttcgcttttgttatttgggatagagaaaaacaagaattgtttggtgctcgggatcat
tttggtatcaaaccactttactatactcaaatgggtggaactttcatgtatggttcagaa
attaaaagttttttgaaacatccaaacttcaaaaaagaattaaataaagaagctttaaaa
ccttacatgactttccaatactctgctcttgatgaaactttctttaaaaatgtttttcgt
atcaaagaaggtcattactttacttacaaagatggggtcttggatatcaaaccttattgg
gatatgaaagttgatgaaaaagatatgagcttggaagaatcaattgatttgattgacaag
actgttttgggttctgttgacgctcataaatttgctgacgtagaagttggagcttttgta
tcaagtggtgtcgattctagttatgttgcttcaacgcttcgtcctgaacatacttattct
attggttttggtcaaggaactttcaatgaatctaaacaagccaaacaattgactgatatg
attggtttgaacaatacttctcgtgaaatccatggagatgaagcgttcaagtatttccca
caaattcaatattatttggacgaaccagactcaaatccttcttgtgtgccactctttttc
ctcgcagaattagcagcacgtgatgtacgtgttgtaatgagcggtgaaggtgcagatgag
ctttttgctggttatgagtcttatggatttagtacaaattctcgtgcggttcgtgttttc
gcagaaggtttgaagaaattaccaaaatctttacgtttctcaattgctcgtggtattgaa
aataaacatttcaaaggtcaaaaacatctttatgaatcacttgcgcctgctgaagatttc
tttatcggtcaagcgaaagtatttgatgagtctgaatcagtagagcttttgaaagaagaa
tttaaagtagctccaaatgttaaagatattgttggaaaaacttacaaaaaggccccagaa
ggttctgaacttcgtaaaatgcaatatcttgatatgcaccaatggatgccaggagatatc
ctacttaaagctgataaaatggcaatggcacactcacttgaattgcgtgttccactactt
gatattgaattgatgcatacagcggaacaaattcctacaaaatatcttttgaatgaacat
aatacaaagtatgctttccgtcaagcagctcgtcgtcatttaccagaagaatggtcaaat
cgtaaaaaattaggtttcccagtgccaattaaagactggttgcgagaagaaaaatattat
aaagttgttcgtcaattatttgaacaagattttgttgctgaattcttcgatcaagaaaaa
ctcttgaagatgttggatgataactttgcagataaaaatgatgcacgtcgtaaactctgg
acaatttattcattcttgacttggtatgatgtttacttcatcaataatggtgaaaaacct
gctgtggttaatttttaa

DBGET integrated database retrieval system