KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0072Help
Entry
llmg_0072         CDS       T00475                                 

Gene name
pdhC
Definition
(GenBank) pyruvate dehydrogenase complex E2 component
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00010  Glycolysis / Gluconeogenesis
llm00020  Citrate cycle (TCA cycle)
llm00620  Pyruvate metabolism
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
llm01200  Carbon metabolism
Module
llm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_0072 (pdhC)
   00020 Citrate cycle (TCA cycle)
    llmg_0072 (pdhC)
   00620 Pyruvate metabolism
    llmg_0072 (pdhC)
Enzymes [BR:llm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     llmg_0072 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl Biotin_lipoyl_2 RnfC_N E3_binding GCV_H ATP-synt_ab_Xtn
Motif
Other DBs
NCBI-ProteinID: CAL96678
UniProt: A2RHE2
Position
complement(66910..68502)
Genome map
AA seq 530 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLMQEILSPYSGTVTKLF
VEEGTTVEVDSPLVEFDGDGSGTSAAAPAPAAQETVSSDAPSGNAQIFTMPDIGEGMHEG
DIANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLIEYN
GNGESTSNPAPAASPAPIAEAPKAAAAPTDAPLTKTTSTGHILAMPSVRHYARKAGIDLT
QVPATGRHGHTTLADVKAFESGSVAPIAPVAPESAPVAPAPKADKATEKAPTVKSVAGDR
REAMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAVFKEVAAKQDIKLTYLAYV
AKALATTAHKFPEINASVDYDKQEIVYHEHVNLGIAVNAPTGLYVPVIHEAETKSILEIA
KEIAELATATREGTLKPQQMQGSTITISNIGSARGSWFTPIINGSDVVILGLGSIVKEPI
VNGEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSLLADPEFMLMEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggcgaaggaatgcacgaaggggacattgcc
aactggttagttaaagttggagatgttgttaaagaagatgatccaattgctgaagtacaa
aatgataaactcatgcaagaaattctctctccctactctgggactgtaacaaaactcttc
gttgaagaaggaacaactgtagaagttgattctcctttggttgagtttgatggagacggg
tcaggaacttctgcagctgctcctgctcctgccgctcaagaaacagtaagttctgatgct
ccttctggcaatgctcaaatcttcaccatgcctgatattggtgaaggaatgcatgaaggc
gatattgccaactggctcgttaaagttggagatgaaattaaagaagatgatcctgttgca
gaggttcaaaacgataaactcatgcaagagattctttctccttactctggaaaagtcact
aaacttttcgtcgaagcaggaacaactgtagaagttggggcccctttgattgaatacaat
ggaaatggtgaatctacaagtaatcctgctcctgctgctagtcctgctccaattgcggaa
gctcctaaagcagccgctgcacctactgatgcgccattgacaaaaacaacttctactgga
catattcttgctatgccatctgtccgtcattatgctcgtaaagcgggaattgatttaact
caagtacctgcaactggtcgtcatgggcatacaactttggctgacgttaaagcttttgaa
tctggtagcgttgcaccaatcgctcctgtggctccagaatcagctcctgtggcacctgcg
cctaaagccgataaagctacggaaaaagccccaactgttaaatctgtggctggagatcgt
cgtgaagcaatgaatccaactcgtaaagttgtttctaaagttatgactgctcaacacact
catattccaccagtaacaaactttgatcaagtggaagtttctaaacttgttaaacatcgc
gccgtctttaaagaagtagcagcaaaacaagatatcaaattgacttaccttgcttatgtt
gctaaagccttggcaactactgctcataagttcccagaaattaatgcttctgttgactat
gataagcaagaaattgtttatcatgaacatgtcaaccttgggattgctgtaaatgcccca
actggtttatatgtcccagtcattcatgaagctgaaactaaatcaattcttgaaattgca
aaagaaattgctgaattagcgactgctacacgtgaaggaacacttaaacctcaacaaatg
caaggttcaacgattacaatttcaaatattggttctgctcgtggttcttggtttacacca
atcatcaacggttctgatgttgtgattttaggtttgggttcaattgttaaagaaccaatt
gtcaatggtgaaggtgaaattgtcgtaggacaaaacatgaaattgtctatgacttatgac
caccgtttgattgatggtatgttgggtcaaacatcacttaactacttgaaatcacttttg
gctgaccctgagttcatgcttatggaaatttaa

DBGET integrated database retrieval system