KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0072Help
Entry
llmg_0072         CDS       T00475                                 

Gene name
pdhC
Definition
pyruvate dehydrogenase complex E2 component (EC:2.3.1.12)
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llmg_0072 (pdhC)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_0072 (pdhC)
   00020 Citrate cycle (TCA cycle)
    llmg_0072 (pdhC)
   00620 Pyruvate metabolism
    llmg_0072 (pdhC)
Enzymes [BR:llm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     llmg_0072 (pdhC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(66910..68502)
Genome map
AA seq 530 aa AA seqDB search
MTEIFKMPDIGEGMHEGDIANWLVKVGDVVKEDDPIAEVQNDKLMQEILSPYSGTVTKLF
VEEGTTVEVDSPLVEFDGDGSGTSAAAPAPAAQETVSSDAPSGNAQIFTMPDIGEGMHEG
DIANWLVKVGDEIKEDDPVAEVQNDKLMQEILSPYSGKVTKLFVEAGTTVEVGAPLIEYN
GNGESTSNPAPAASPAPIAEAPKAAAAPTDAPLTKTTSTGHILAMPSVRHYARKAGIDLT
QVPATGRHGHTTLADVKAFESGSVAPIAPVAPESAPVAPAPKADKATEKAPTVKSVAGDR
REAMNPTRKVVSKVMTAQHTHIPPVTNFDQVEVSKLVKHRAVFKEVAAKQDIKLTYLAYV
AKALATTAHKFPEINASVDYDKQEIVYHEHVNLGIAVNAPTGLYVPVIHEAETKSILEIA
KEIAELATATREGTLKPQQMQGSTITISNIGSARGSWFTPIINGSDVVILGLGSIVKEPI
VNGEGEIVVGQNMKLSMTYDHRLIDGMLGQTSLNYLKSLLADPEFMLMEI
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgactgagatttttaaaatgcctgatattggcgaaggaatgcacgaaggggacattgcc
aactggttagttaaagttggagatgttgttaaagaagatgatccaattgctgaagtacaa
aatgataaactcatgcaagaaattctctctccctactctgggactgtaacaaaactcttc
gttgaagaaggaacaactgtagaagttgattctcctttggttgagtttgatggagacggg
tcaggaacttctgcagctgctcctgctcctgccgctcaagaaacagtaagttctgatgct
ccttctggcaatgctcaaatcttcaccatgcctgatattggtgaaggaatgcatgaaggc
gatattgccaactggctcgttaaagttggagatgaaattaaagaagatgatcctgttgca
gaggttcaaaacgataaactcatgcaagagattctttctccttactctggaaaagtcact
aaacttttcgtcgaagcaggaacaactgtagaagttggggcccctttgattgaatacaat
ggaaatggtgaatctacaagtaatcctgctcctgctgctagtcctgctccaattgcggaa
gctcctaaagcagccgctgcacctactgatgcgccattgacaaaaacaacttctactgga
catattcttgctatgccatctgtccgtcattatgctcgtaaagcgggaattgatttaact
caagtacctgcaactggtcgtcatgggcatacaactttggctgacgttaaagcttttgaa
tctggtagcgttgcaccaatcgctcctgtggctccagaatcagctcctgtggcacctgcg
cctaaagccgataaagctacggaaaaagccccaactgttaaatctgtggctggagatcgt
cgtgaagcaatgaatccaactcgtaaagttgtttctaaagttatgactgctcaacacact
catattccaccagtaacaaactttgatcaagtggaagtttctaaacttgttaaacatcgc
gccgtctttaaagaagtagcagcaaaacaagatatcaaattgacttaccttgcttatgtt
gctaaagccttggcaactactgctcataagttcccagaaattaatgcttctgttgactat
gataagcaagaaattgtttatcatgaacatgtcaaccttgggattgctgtaaatgcccca
actggtttatatgtcccagtcattcatgaagctgaaactaaatcaattcttgaaattgca
aaagaaattgctgaattagcgactgctacacgtgaaggaacacttaaacctcaacaaatg
caaggttcaacgattacaatttcaaatattggttctgctcgtggttcttggtttacacca
atcatcaacggttctgatgttgtgattttaggtttgggttcaattgttaaagaaccaatt
gtcaatggtgaaggtgaaattgtcgtaggacaaaacatgaaattgtctatgacttatgac
caccgtttgattgatggtatgttgggtcaaacatcacttaactacttgaaatcacttttg
gctgaccctgagttcatgcttatggaaatttaa

DBGET integrated database retrieval system