KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0207Help
Entry
llmg_0207         CDS       T00475                                 

Gene name
rmlC
Definition
dTDP-4-keto-6-deoxyglucose-3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:llm00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:llm00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
196330..196923
Genome map
AA seq 197 aa AA seqDB search
MTENFFGKTLASREISQIPGMLEFDIPVHGDNRGWFKENFQKEKMMPLGFPESFFAEEKL
QNNVSFSRKNVLRGLHAEPWDKYISVADGGSVLGAWVDLREGENFGHVYQTVIDASKGIF
VPRGVANGFQVLSDTVSYSYLVNDYWALELKPKYAFVNYADPTLGIKWEDVENAEVSEAD
KNHPMLKDVKPLKADEL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgactgagaattttttcggaaaaacacttgctagtcgagaaattagtcaaattccagga
atgttagaatttgatattccggttcatggtgataatcgtggttggtttaaagaaaatttt
caaaaagaaaaaatgatgcctcttggttttccagaaagtttttttgctgaagaaaaattg
caaaataatgtaagtttctctcgtaaaaatgttttgcgtgggcttcatgccgaaccttgg
gataaatatatttctgttgctgatggtggctctgttttgggtgcatgggttgatttacgc
gaaggcgaaaattttggtcatgtttaccaaacagtcattgatgcaagtaaaggaattttc
gttccacgcggcgtggctaatggtttccaagttttatctgatacagtttcttatagctat
ctggttaatgattactgggcacttgaacttaaacctaaatatgcttttgtaaactacgct
gacccaacattgggaatcaagtgggaagatgttgaaaatgctgaagtttctgaagcagat
aaaaatcatccaatgttaaaagatgtaaaacctttaaaggctgatgaactctaa

DBGET integrated database retrieval system