KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0355Help
Entry
llmg_0355         CDS       T00475                                 

Gene name
gpmA
Definition
(RefSeq) phosphoglyceromutase (EC:5.4.2.1)
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llmg_0355 (gpmA)
   01230 Biosynthesis of amino acids
    llmg_0355 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_0355 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    llmg_0355 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llmg_0355 (gpmA)
Enzymes [BR:llm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     llmg_0355 (gpmA)
Exosome [BR:llm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   llmg_0355 (gpmA)
  Exosomal proteins of melanoma cells
   llmg_0355 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
341375..342076
Genome map
AA seq 233 aa AA seqDB search
MPKLVFARHGESEWNLANLFTGWADVDLSENGTKQAIEAGKLIKEAGIEFDIAYTSVLKR
AIKTTNLALEFSDQLWVPVVKSWRLNERHYGGLTGLNKADAAAKHGDEQVHIWRRSYDVL
PPAMDHDDKYTAHGDRRYAGLEDSLIPDAENLKVTLERALPFWEDQIAPALKEGKNVFVG
AHGNSIRALVKQIKKLSDDEIMDVEIPNFPPLVFEFDDNLNVQNEYYLAPKKA
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattagtatttgcacgtcacggtgaatctgaatggaatcttgctaaccttttc
acaggttgggctgacgttgacctttctgaaaacggaactaaacaagcgattgaagctggt
aaattgattaaagaagctggaatcgaatttgatattgcatacacttcagtattgaaacgt
gcgatcaaaacaactaaccttgctcttgaattttcagatcaactttgggtaccagttgtt
aaatcatggcgcttgaacgaacgtcactacggtggtttgacaggtttgaacaaagctgac
gctgctgcaaaacatggtgatgaacaagttcacatctggcgtcgttcatatgatgtattg
ccacctgcaatggatcatgatgataaatatacagctcacggagaccgtcgttatgctggt
cttgaagattcattgattcctgatgctgaaaacctcaaagttactttggaacgcgctctt
ccattctgggaagaccaaatcgctccagctttgaaagaaggaaaaaatgtcttcgttggt
gctcacggtaactcaattcgcgccctcgttaaacaaatcaaaaaactttctgatgacgaa
attatggatgttgaaatccctaacttcccaccacttgttttcgaatttgatgacaatttg
aacgttcaaaacgaatactatttggctccaaaaaaagcttaa

DBGET integrated database retrieval system