KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0372Help
Entry
llmg_0372         CDS       T00475                                 

Gene name
asnB
Definition
asparagine synthetase B (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    llmg_0372 (asnB)
Enzymes [BR:llm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     llmg_0372 (asnB)
Peptidases [BR:llm01002]
 Cysteine Peptidases
  Family C44
   llmg_0372 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
363700..365292
Genome map
AA seq 530 aa AA seqDB search
MCGFLFMETSDLTIEEFKSNLELIEHRGPDDQQHVRDTLGNDFGFCRLSIMDLSDLGRQP
FGLNGKRVMCNGEIYNFLSLRKFLETKGYKFTGDSDCEVLLPLFETTGIETMVKMLDAEF
AFVLVDENTGEIFAARDPFGIRPLFYGYNKVTGKISFSSEAKALISTCKDVTPFPPGYYY
AGGEFHVYNDIAEVSTIVEEPLAEISGHIRRKLERAVKKRLHADAPMGYLLSGGLDSSLV
CAIAAKELESPIKTFAIGMETDPIDLKYAREVADFLRTDHTEILMTKEDVLSAVREVIWH
LETWDITTIRASIGMYLICKYIHENTELKVLMTGEVSDEMFGYKYTDFAPSAGAFQKEAQ
KRVHELYMYDVLRADRCLAAHSLEARVPFADLDFATYVMSINPSRKLNTYGKGKYLLRHA
FEGTELLPDEILFREKAAFSDAVGHSMVDYLKEFADEKYSDEDLAKASEKYPKHTPFTKE
SLMYREIFEEFYPGYEDWILDFWMPNRDWVGAEVTDPSARVLSNYGDSGK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggttttttatttatggaaacatctgacttaacgatagaagagtttaaaagcaat
ttggaactgattgaacatcgaggaccagacgaccaacaacatgttcgtgatactttggga
aatgattttggtttttgccgactttcaatcatggatttgtcagacttggggcgtcagccc
tttggactgaacgggaaaagagttatgtgtaatggtgaaatttataactttttaagcctt
cgtaagttcttggaaactaagggatataaatttacaggagattctgattgtgaagtgctt
ttacctctttttgaaaccacaggaatcgaaacaatggtcaaaatgcttgatgctgaattt
gcttttgtactagttgatgaaaatactggtgaaatttttgccgctcgtgatccttttgga
attcgtccacttttttatggttataataaagttacggggaaaatttctttctcttctgaa
gctaaggcccttatttcaacctgtaaagatgtgacgccttttccaccaggttattattat
gcaggtggtgaatttcatgtttataatgatattgcggaagtttcaacgattgttgaagaa
cctttggctgaaatttcaggacatatccgtcgcaaattggaacgtgcagttaaaaaacgt
cttcatgcagatgctccaatgggttatctcttgtcaggcggtttagattcatcattggtc
tgtgccattgcagctaaagaattagaaagtccaatcaagacctttgcgattggaatggaa
acagacccgattgatttgaaatatgctcgggaagtagcagatttcttacggactgaccat
accgaaattttgatgacaaaagaagacgtactttcagcagttcgtgaagtgatttggcat
ttggaaacttgggatatcacgacgattcgggcttctattgggatgtatttaatctgtaag
tatattcatgagaatacagagctgaaagttttgatgaccggtgaggtttccgatgaaatg
ttcggctataaatatactgactttgctccatcagctggggcctttcaaaaagaagcccaa
aaacgagtgcatgaactttatatgtatgatgtcctgcgggctgaccgctgtttagcggct
cattctcttgaagcgcgtgttccatttgctgacttggattttgcgacttatgtcatgtcc
atcaatcccagcagaaagctgaatacttatggcaaaggaaaatatctcttgcgtcatgct
tttgaaggaacggagctattaccagacgagattttatttagagaaaaagcggctttttct
gatgctgttggtcattccatggtcgactatttaaaagaatttgctgacgaaaaatattct
gatgaagatttagcaaaggccagtgaaaagtatccaaaacatacaccatttaccaaagaa
tccttgatgtatcgggaaatttttgaagaattttatccaggatatgaagattggattctt
gatttttggatgccaaatcgcgattgggttggggcagaagttactgacccatcagctcgc
gtcttatcaaattatggtgattctggaaaataa

DBGET integrated database retrieval system