KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0441Help
Entry
llmg_0441         CDS       T00475                                 

Gene name
celA
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_0441 (celA)
Enzymes [BR:llm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     llmg_0441 (celA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
431698..433134
Genome map
AA seq 478 aa AA seqDB search
MTLKKDFLWGGAVAAHQLEGGWNAGGKGVSVADVMTAGSNGVERKITDGVIEGENYPNHE
AIDFYHHYKEDVALFAELGLNCFRTSIAWTRIFPKGDESEPNEEGLQFYDDLFDECLKNG
IEPVITLSHFELPYHLVTEYGGFRNRKLIDFFVHFSEVVMNRYKDKVKYWMTFNEINNQA
NFMRDFAPFTNSGLKFPEGASEKEREEIMYQAAHYELVASAKVVELGHKINPDFQIGCMI
AMCPIYPATCKPEDMMASTVAMQRRYWFADVHVRGHYPSYLKAYFERKEFKLDISDEDLE
VLKNGKVDYIGFSYYMSFAIKDHGKAPTFDYNEDKDLVKNDYVKASEWGWQIDPLGLRYA
MNWFYERYEKPLFIVENGFGAVDEVEADGSIHDPYRIEYLKAHIESMKEAVEYDGVDLMG
YTPWGFIDLVSAGTGEMKKRYGVIYVDKDNEGNGTLKRSKKDSFDWYQKVIATNGEEL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgactttaaaaaaagacttcctctggggaggagcagttgctgcacatcaacttgaagga
ggctggaatgctggtggaaagggagtttccgtagcagatgtgatgacagcaggtagtaac
ggcgtagaaagaaaaatcacagatggagtaattgagggagaaaattaccctaatcatgaa
gctattgatttctatcaccactataaagaagatgtagcactttttgcagaactcggttta
aattgttttagaacatctattgcttggacacgcatttttcctaagggagatgagtctgaa
cctaacgaagagggcttgcaattctatgatgacttatttgatgaatgtttaaaaaatggt
attgaacctgtcattactctttctcactttgaacttccttatcatttagtgacagagtat
ggtggattccgaaaccgaaaactcattgatttctttgtccatttttcagaagtagtgatg
aatcgttataaagataaagttaagtattggatgactttcaatgaaattaataaccaagca
aactttatgcgcgactttgccccttttaccaattctggtttgaaatttccagagggagca
agcgaaaaagagcgtgaagaaatcatgtatcaagcggctcattatgaacttgttgcctcg
gccaaagttgtagagttgggacataaaattaatcctgatttccaaattggttgtatgatt
gccatgtgtccgatttatcctgcaacttgtaaaccggaagacatgatggcttcaaccgtt
gctatgcaacgtcgttattggtttgcagatgtccacgttcgcggacattacccaagttat
ttaaaggcttattttgaacgtaaagaatttaaacttgatattagtgatgaagacttagaa
gttttgaaaaatggaaaagttgattatattggtttttcttactatatgagttttgcaatt
aaggaccatggaaaagccccaacttttgattataacgaagataaagatttagttaaaaat
gactatgttaaggcttctgaatgggggtggcaaattgacccattaggtttacgttatgcg
atgaattggttctatgaacgttatgaaaaaccacttttcattgttgaaaatggctttggt
gctgtagatgaagttgaagctgatggaagtattcacgacccatatcgaattgaatattta
aaagctcatatagaatcaatgaaagaagctgttgaatatgatggggttgatttaatggga
tatactccttggggctttattgaccttgtttctgctggaaccggtgagatgaaaaaacgc
tatggtgtcatctatgtggacaaagataatgaaggaaatggaacattaaaacgctctaaa
aaagattcatttgattggtatcagaaagttattgcaaccaatggtgaagaactttaa

DBGET integrated database retrieval system