KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0494Help
Entry
llmg_0494         CDS       T00475                                 

Gene name
nagZ
Definition
beta-N-acetylglucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    llmg_0494 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    llmg_0494 (nagZ)
Enzymes [BR:llm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     llmg_0494 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488285..489505
Genome map
AA seq 406 aa AA seqDB search
MTKRLKKQAKPVVFLGLVIGCALIVSGVLGLSGHLNNQEAIKSKKKNQVSETKTNSSSQN
KSDPKMPKMPKMTLEQKVGQLFMTGMPANNYDQATFDAIEKYQVGSIILTGRSNLSIPEM
KDITDKLQGLAPANRRLLISCDQEGGNVQVLQGAGFSEMPNGLTQGSWAPEKLQEEAKNW
GSELSAAGINFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKANIVSHADAFSKGMKSA
GVLTTAKHFPGLGAVTGNTDISAGVRDGQTNPKSESVQIFKELISSGVPSIMTATAIYDQ
IDLELPGAFSPKMVDGLLRNQLDFDGLVITDDLSNAVQVQAWSPGQRAVLALAAGNDLVL
ANEPTQIPEMISEVLQKAKSDQEFAEKINQASSRVMKVKEQMKLVE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaagattaaagaaacaagcaaaaccagtcgtttttctaggccttgttattggt
tgtgcacttattgtgtcaggagttcttggtctgtcaggacatttaaataatcaagaagca
atcaaaagcaaaaagaaaaatcaagtttcagaaacaaaaactaattcaagtagtcaaaat
aaaagtgacccaaaaatgccaaaaatgccaaaaatgactttagaacaaaaagtgggtcag
ttatttatgacggggatgcctgcaaataactatgaccaagcaacttttgatgcgattgaa
aaatatcaggttgggagtatcattttgacgggccgctctaatctcagtattcctgaaatg
aaagatattactgacaagctacaaggcttagcacctgctaatcgacgtcttttgatttct
tgtgatcaagagggaggaaatgttcaggttcttcaaggggctggtttttcagaaatgcct
aatggattgacccaaggaagttgggcgccagaaaaattacaagaagaagctaaaaattgg
gggagtgaactttcagccgctggaatcaattttgatttagccccagttgctgaccaggta
ttatctgctgattttgcaccacaaaatgctccgattggctactggagtcgtcagtatgct
tatgacaaagctaatattgtcagtcatgctgatgctttttctaaaggaatgaaatcagct
ggtgttttaacaaccgctaagcattttccagggcttggagcggtgacaggtaacacggat
atcagtgctggtgttagagatgggcaaacaaatcctaaaagtgaatccgttcagattttt
aaagaattaatttcttcgggagttccatcaattatgacggcgacagcaatttatgatcaa
attgaccttgagcttccgggagccttctcacctaaaatggttgatggcttactccgaaat
caattagactttgatggtttggtaattactgacgatttatcaaacgctgttcaagttcaa
gcttggtcaccaggccaaagagcagtattggcgctggcagcgggaaatgaccttgtccta
gccaatgagcccactcaaattccagaaatgatttcagaagttttgcaaaaagcaaaatct
gatcaggaatttgcagaaaaaattaatcaagcatcatcaagggtgatgaaagtaaaagaa
caaatgaaacttgtagaatag

DBGET integrated database retrieval system