KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0494Help
Entry
llmg_0494         CDS       T00475                                 

Gene name
nagZ
Definition
beta-N-acetylglucosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:llm00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:llm00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
488285..489505
Genome map
AA seq 406 aa AA seqDB search
MTKRLKKQAKPVVFLGLVIGCALIVSGVLGLSGHLNNQEAIKSKKKNQVSETKTNSSSQN
KSDPKMPKMPKMTLEQKVGQLFMTGMPANNYDQATFDAIEKYQVGSIILTGRSNLSIPEM
KDITDKLQGLAPANRRLLISCDQEGGNVQVLQGAGFSEMPNGLTQGSWAPEKLQEEAKNW
GSELSAAGINFDLAPVADQVLSADFAPQNAPIGYWSRQYAYDKANIVSHADAFSKGMKSA
GVLTTAKHFPGLGAVTGNTDISAGVRDGQTNPKSESVQIFKELISSGVPSIMTATAIYDQ
IDLELPGAFSPKMVDGLLRNQLDFDGLVITDDLSNAVQVQAWSPGQRAVLALAAGNDLVL
ANEPTQIPEMISEVLQKAKSDQEFAEKINQASSRVMKVKEQMKLVE
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgaccaaaagattaaagaaacaagcaaaaccagtcgtttttctaggccttgttattggt
tgtgcacttattgtgtcaggagttcttggtctgtcaggacatttaaataatcaagaagca
atcaaaagcaaaaagaaaaatcaagtttcagaaacaaaaactaattcaagtagtcaaaat
aaaagtgacccaaaaatgccaaaaatgccaaaaatgactttagaacaaaaagtgggtcag
ttatttatgacggggatgcctgcaaataactatgaccaagcaacttttgatgcgattgaa
aaatatcaggttgggagtatcattttgacgggccgctctaatctcagtattcctgaaatg
aaagatattactgacaagctacaaggcttagcacctgctaatcgacgtcttttgatttct
tgtgatcaagagggaggaaatgttcaggttcttcaaggggctggtttttcagaaatgcct
aatggattgacccaaggaagttgggcgccagaaaaattacaagaagaagctaaaaattgg
gggagtgaactttcagccgctggaatcaattttgatttagccccagttgctgaccaggta
ttatctgctgattttgcaccacaaaatgctccgattggctactggagtcgtcagtatgct
tatgacaaagctaatattgtcagtcatgctgatgctttttctaaaggaatgaaatcagct
ggtgttttaacaaccgctaagcattttccagggcttggagcggtgacaggtaacacggat
atcagtgctggtgttagagatgggcaaacaaatcctaaaagtgaatccgttcagattttt
aaagaattaatttcttcgggagttccatcaattatgacggcgacagcaatttatgatcaa
attgaccttgagcttccgggagccttctcacctaaaatggttgatggcttactccgaaat
caattagactttgatggtttggtaattactgacgatttatcaaacgctgttcaagttcaa
gcttggtcaccaggccaaagagcagtattggcgctggcagcgggaaatgaccttgtccta
gccaatgagcccactcaaattccagaaatgatttcagaagttttgcaaaaagcaaaatct
gatcaggaatttgcagaaaaaattaatcaagcatcatcaagggtgatgaaagtaaaagaa
caaatgaaacttgtagaatag

DBGET integrated database retrieval system