KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0627Help
Entry
llmg_0627         CDS       T00475                                 

Gene name
fadD
Definition
long-chain acyl-CoA synthetase (EC:6.2.1.1)
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    llmg_0627 (fadD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_0627 (fadD)
   00620 Pyruvate metabolism
    llmg_0627 (fadD)
   00640 Propanoate metabolism
    llmg_0627 (fadD)
  Energy metabolism
   00680 Methane metabolism
    llmg_0627 (fadD)
Enzymes [BR:llm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     llmg_0627 (fadD)
Lipid biosynthesis proteins [BR:llm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   llmg_0627 (fadD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(615570..617093)
Genome map
AA seq 507 aa AA seqDB search
MKFKHEPLNLYLNFKKSAEQFPYSPIIFDQTVGAFPELALETTYQKTHQAIVDKASLLSE
LGIKKSDKVIIFKSSAFDTYLLAVAVSYLGAVPAMISYHLPAETMDILAGRLDDPWLIYD
QVTDQTVTEMKNLKNSKKLSVSKFASQKPSHLVDSQQLDNDEIAYLTHTSGTTGVPKLIA
HSANSMGWRWVLQRTVMDWMPDKKEILAFHISPVHSRFNIGVSSAMTFGFGLMPLNDLSR
INLVNLFSKHQPYAFETHPNDFVRLANLAKQEPEIFSSIRYLHSTFDAINKETMHTFLSA
SKHDNPVFLQIYGQSECGPMIWKKHRLSTLADTDAREMGIGMPGLSKARIADENGNECPA
GIPGRIHFLSKGRALTYYKEEDRFNKEVYGDWWDTGDWGLMNEEGNLFLHDRQVDLIDKI
ESNLAIEDLLLDQHDFLDEVVIIRDKSGKPQPILALADNAEMDWSAWWASIVDLPFLNEP
ILMAYDEIPRTATMKVQRLALERDLAK
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
ttgaaattcaaacatgaacccctaaacctatatctaaactttaaaaaatcagcagaacaa
tttccttatagcccaattatttttgaccaaactgttggtgccttccctgaattagctctg
gaaacaacttaccaaaagacccatcaagcaattgttgataaggcaagccttttatcggaa
ctaggaatcaaaaaatctgacaaagtcattatttttaaatcaagtgcttttgatacctat
cttcttgccgtagctgtttcttatctcggcgctgttccagcaatgatttcttaccacctt
ccagctgaaacaatggatattttagctggtcgtttagatgacccttggctcatttatgac
caagtgactgaccagactgtgacagagatgaaaaatcttaagaattctaaaaaactttct
gttagcaaatttgcttcgcaaaaaccaagtcatcttgttgacagtcagcaactggataat
gacgagattgcttatctcactcatacttctggaacaactggtgttccgaaattgattgcc
cactctgccaattctatgggctggcgttgggtgcttcaaagaacggtcatggattggatg
cccgataaaaaagaaattttggctttccacatttcgcccgttcattctcgtttcaatatt
ggcgtttcatctgccatgacctttggttttggcctaatgccacttaatgatttatcaaga
attaatcttgtcaatctattttctaaacatcagccttatgcttttgaaactcaccctaat
gactttgttcgcttggcgaatcttgcgaagcaggaacctgaaattttttcttcaattcgc
tatcttcattcaacttttgatgcgattaataaagaaacaatgcatactttcttatcagcc
tctaaacacgacaacccagtctttttacaaatctatggtcagtcagaatgcggtccaatg
atttggaaaaaacaccgtttatcaaccctagcagatactgatgctcgtgaaatgggaatt
ggtatgcctggtctttctaaggcacgtattgctgacgaaaatggaaatgaatgccctgca
ggtattcctggaagaattcatttcctttctaaaggacgtgctttgacttactacaaagaa
gaggatcgtttcaacaaagaagtctatggcgactggtgggatactggcgattggggccta
atgaatgaagaaggaaatcttttcctccatgaccgtcaagtcgatttaattgataaaatt
gaatcaaatttagcaattgaagacctccttttagatcaacatgattttttagatgaagtt
gtgattattcgcgataaatctggaaaaccacaacctatcttagccttggctgacaatgcg
gaaatggattggtcagcttggtgggcttcaattgttgacttaccatttttaaatgaacct
attctcatggcttacgatgaaattccacgtactgcaacaatgaaagttcaaagattagct
cttgaaagagacttagccaaataa

DBGET integrated database retrieval system