KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0751Help
Entry
llmg_0751         CDS       T00475                                 

Gene name
arb
Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:llm00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
738330..739763
Genome map
AA seq 477 aa AA seqDB search
MPFSKDFLWGGATAANQCEGGYNQGGRGLANVDLVPHGKDRFPIITGEMKHLEFDEEHFY
PAKEAIDMYHHWKDDLALFAEMGFKTYRMSIAWTRIFPKGDEQEPNEEGLQFYEDIFKEC
KRLGIEPLVTITHFDCPVHLIKEYGGWRNRKMVGFYEKLARTIFTRFKGLVRYWLTFNEI
NMLLHAPFMGAGLVFEEGENKEQAKYLAAHHELLASALATKIAHEIDPENKIGCMLAAGE
YYPFDCNPENVLEAQKQNHDNLFFIDVQSRGKYPNYLLKRLEREDVQLPIETGDLEILAE
NTVDFISFSYYSSRVAKIKDKDADKSAGNIFESVTNPYLKASEWGWQIDPLGLRITMNSI
YDRYQKPLFVVENGLGALDKPDENGFVADDYRIDYMAAHIKEMKKAVELDGVELLGYTSW
GCIDLVSAGTGEMSKRYGFIYVDRDDFGKGTLKRTSKKSFDWYKKVIASNGEDLTNE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgccatttagtaaagattttctctggggcggagctaccgcggctaatcaatgtgaaggc
ggctataatcaaggaggacgtggacttgctaacgttgatcttgtgcctcacggaaaagac
cgttttccaattattacaggggaaatgaagcaccttgaatttgacgaggaacatttctat
cctgcaaaagaagcgattgatatgtatcaccattggaaagatgacctcgccctttttgct
gaaatgggctttaagacctatcgaatgtcaattgcttggacacgaattttccccaaagga
gatgaacaagaaccaaacgaagaaggcttgcaattttacgaagatatttttaaagaatgc
aaacgtttaggaattgagccgttagttaccattactcactttgattgtccagttcatttg
attaaagaatatgggggctggcgtaaccgaaaaatggttggcttttatgaaaaactggcg
agaacaatttttactcgctttaaaggattggttcgctattggctgacatttaatgagatt
aatatgctactccatgctccattcatgggggcaggacttgtctttgaagaaggggaaaat
aaagaacaagccaaatatttggctgctcatcatgaacttttggcttcagctttggcaaca
aaaatagctcatgaaattgatccagaaaataaaattggctgtatgttggccgctggcgaa
tattatccatttgattgtaatccagaaaatgtgttggaagctcaaaaacaaaatcatgac
aatctctttttcattgatgtccaatcgcgtgggaaatatcctaactatcttctaaaaaga
ttagaacgtgaggatgttcaacttccaattgaaacgggtgatttagaaattttagcagaa
aatactgttgattttatttcatttagctattattctagtcgagtggctaagataaaagac
aaggacgcagataagtcagctggtaatatttttgagtctgtcactaatccctatttaaag
gcaagtgaatggggctggcaaattgaccctcttggactccgaattacaatgaattctatt
tatgatcgttatcaaaaaccactgtttgttgttgaaaatggtttaggagctcttgataaa
ccagatgaaaatggctttgtagcagatgactatcgaattgattatatggctgctcacatc
aaagaaatgaaaaaagcggttgaacttgatggtgttgagctactcggatatacttcttgg
ggatgtattgacttggtttcagcaggtactggtgaaatgagtaaacgttacggattcatc
tatgttgaccgagatgattttggtaaaggaactttgaaacggacatctaagaagtcattt
gattggtataaaaaagtgattgcaagtaatggtgaagatttaacaaatgaatga

DBGET integrated database retrieval system