KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0890Help
Entry
llmg_0890         CDS       T00475                                 

Gene name
pyrR
Definition
bifunctional pyrimidine regulatory protein PyrR/uracil phosphoribosyltransferase (EC:2.4.2.9)
Orthology
K02825  
pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    llmg_0890 (pyrR)
Enzymes [BR:llm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.9  uracil phosphoribosyltransferase
     llmg_0890 (pyrR)
Transcription factors [BR:llm03000]
 Prokaryotic Type
  Other transcription factors
   Others
    llmg_0890 (pyrR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861083..861604
Genome map
AA seq 173 aa AA seqDB search
MARKEIIDEITMKRAITRITYEIIERNKELDKLVLIGIKTRGVYLAKRIQERLQQLEGLE
IPFGELDTRPFRDDKQAQEDTTEIDIDITGKDVILVDDVLYTGRTIRAAIDGIVKLGRPA
RVQLAVLVDRGHRELPIRADYVGKNIPTGHDEEIIVQMSEHDGNDSILIKRED
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaaagaaattattgacgaaatcacaatgaaacgtgcaattacacggatcact
tacgagattattgaacgtaataaagaactggacaaattggttttgattgggattaagaca
cgcggtgtttatttggccaaaagaatccaagaacgtttgcaacaactggaaggtttggaa
attccttttggtgagctggatacacgtccattccgtgatgataaacaagcacaagaagat
acaacagaaattgatatcgatattacaggaaaagatgtcattcttgttgatgatgtgctc
tacacaggtcggacaattcgtgcggcaattgacggaatcgtaaaacttggtcgcccagcc
cgtgttcaattggctgttttagttgaccgtggacatcgcgaattaccaattcgtgcagac
tacgttgggaaaaatattccaacaggtcatgatgaagaaatcatcgttcaaatgtctgag
catgatggcaatgacagtattttaatcaaacgtgaagattaa

DBGET integrated database retrieval system