KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0890Help
Entry
llmg_0890         CDS       T00475                                 

Gene name
pyrR
Definition
bifunctional pyrimidine regulatory protein PyrR/uracil phosphoribosyltransferase (EC:2.4.2.9)
Orthology
K02825  
pyrimidine operon attenuation protein / uracil phosphoribosyltransferase [EC:2.4.2.9]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:llm00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
861083..861604
Genome map
AA seq 173 aa AA seqDB search
MARKEIIDEITMKRAITRITYEIIERNKELDKLVLIGIKTRGVYLAKRIQERLQQLEGLE
IPFGELDTRPFRDDKQAQEDTTEIDIDITGKDVILVDDVLYTGRTIRAAIDGIVKLGRPA
RVQLAVLVDRGHRELPIRADYVGKNIPTGHDEEIIVQMSEHDGNDSILIKRED
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggctagaaaagaaattattgacgaaatcacaatgaaacgtgcaattacacggatcact
tacgagattattgaacgtaataaagaactggacaaattggttttgattgggattaagaca
cgcggtgtttatttggccaaaagaatccaagaacgtttgcaacaactggaaggtttggaa
attccttttggtgagctggatacacgtccattccgtgatgataaacaagcacaagaagat
acaacagaaattgatatcgatattacaggaaaagatgtcattcttgttgatgatgtgctc
tacacaggtcggacaattcgtgcggcaattgacggaatcgtaaaacttggtcgcccagcc
cgtgttcaattggctgttttagttgaccgtggacatcgcgaattaccaattcgtgcagac
tacgttgggaaaaatattccaacaggtcatgatgaagaaatcatcgttcaaatgtctgag
catgatggcaatgacagtattttaatcaaacgtgaagattaa

DBGET integrated database retrieval system