KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0930Help
Entry
llmg_0930         CDS       T00475                                 

Gene name
thiL
Definition
(GenBank) ThiL protein
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    llmg_0930 (thiL)
   00630 Glyoxylate and dicarboxylate metabolism
    llmg_0930 (thiL)
   00640 Propanoate metabolism
    llmg_0930 (thiL)
   00650 Butanoate metabolism
    llmg_0930 (thiL)
  Lipid metabolism
   00071 Fatty acid degradation
    llmg_0930 (thiL)
   00072 Synthesis and degradation of ketone bodies
    llmg_0930 (thiL)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    llmg_0930 (thiL)
   00310 Lysine degradation
    llmg_0930 (thiL)
   00380 Tryptophan metabolism
    llmg_0930 (thiL)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    llmg_0930 (thiL)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    llmg_0930 (thiL)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    llmg_0930 (thiL)
Enzymes [BR:llm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     llmg_0930 (thiL)
Exosome [BR:llm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   llmg_0930 (thiL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
899909..901069
Genome map
AA seq 386 aa AA seqDB search
MTFGGSFVKEIVIIDALRTPVGKYDGALAEYSAEKLGTHVVSALLSKNKNIKSDVEQVIF
GNVLQAGNGQNIARQIAINSGLSTSVPASTINEVCGSGMKAVILAKQLLQLGEAEVVIAG
GTESMSNAPILKNRKTEEETLSMLSDGLIDAFSGISMGIIGETIAEQFDVSRADQDLFAQ
NSQEKAVAASQAGIFNDEIVALGKLTVDETPRPSSSLEKLATLRTAFKENGTVTAGNSSP
VNDGASALILATKEYAEKHGISYLAELVESAEVGIDPAIMGVSPIDAIQKLVQRSGVQLS
EIDLFEINEAFAASSIAVNRELGLKDSQVNIYGGAIALGHAIGSSGAKILTTLGYALKRE
QKRYGIASLCIGGGLGLAILLKNPDF
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgactttcggaggttcattcgtgaaagaaattgtaatcattgacgccttaagaacacca
gtcggaaaatatgatggtgctcttgctgagtattcggcagaaaagcttggaacacacgtt
gtttcagctttattgtcaaaaaataaaaatataaaatcagatgttgaacaagttattttt
ggtaatgttcttcaagctggtaatggtcaaaatattgcgcgccaaattgcgattaatagt
ggtttatcaaccagtgttccagcttcaaccattaatgaagtttgtggttcagggatgaag
gcagtaattctagctaagcaacttttacagttgggcgaagcagaagttgttattgctggt
ggaacggaatcaatgtctaatgcgcctattcttaaaaatcgtaaaactgaagaagaaaca
ttaagcatgttaagtgacggcttaattgatgctttttctggcatttcaatgggaattatt
ggagaaacaattgcggagcagtttgatgttagtcgtgctgaccaagacctattcgcacaa
aattctcaagagaaggcagtagcagccagtcaagcaggaatttttaatgacgagatcgta
gctcttgggaaacttactgttgatgaaactcctcgaccttcatctagcctagaaaaattg
gctacattacggacagcctttaaggaaaatggaacagttacagctgggaattcttcacca
gttaatgacggagcttctgctttaattttggccactaaagagtatgctgaaaaacatgga
atttcttatttagctgaattagttgagagtgcggaagttggtattgaccctgcaattatg
ggagtatcaccgattgatgcaattcaaaaattagttcaacgctcaggcgttcagctttca
gaaatagatctttttgaaattaatgaggcctttgctgcatcaagtattgctgttaatcgt
gaattgggcttaaaagattctcaagttaatatttatggaggagcgattgctcttggacat
gctattgggtcaagtggtgccaaaatcctgacaactttgggatatgctttgaaacgagaa
caaaagcgttatggaattgctagtctttgtattggcggtggtctagggcttgctatttta
ttgaaaaatcctgacttttaa

DBGET integrated database retrieval system