KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0935Help
Entry
llmg_0935         CDS       T00475                                 

Definition
lysophospholipase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    llmg_0935
Enzymes [BR:llm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     llmg_0935
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
904223..905068
Genome map
AA seq 281 aa AA seqDB search
MKKQYEIISMKDHYRIRLGIFEPQEKAKGVVQLVHGFGEYTGHYLYLINELVNAGFVCFM
HDQRGHGVLAAAKPKLQGRARNYENFISDALEVRKIIGKRYPKLPVYLFGHSMGGNISLN
VLLRNVENQKLYQKAVIESPWLALTNPPAIPLQKLAQVLGKFNSKIRVRTGLKVDAISHR
SDLVDLVTKDGIYHELLSLRLFSQIMEAGRFAQSQAEQLKIPTLLFCGEEDQICSPLAIR
SFAENAGANLELVEVAEGYHALHLDTKADAFIDKMKAFLLE
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacagtatgaaattatttcaatgaaagatcactatcggattcgtcttggaatt
tttgaaccacaagaaaaagcaaaaggcgtggtgcaattagttcatggttttggcgaatat
acgggtcattatttatatttaatcaatgaattagttaatgctggttttgtttgctttatg
cacgaccaaagaggacatggggttctagcagcagctaaacctaaacttcaaggacgagca
agaaattatgaaaactttattagtgatgctttagaagtccgaaaaataattggcaaaaga
tatcccaaattaccagtttatctcttcggacacagtatgggaggaaatatttcactgaat
gttctgctgagaaatgttgaaaatcaaaaactttatcaaaaagcagttattgaatctcct
tggcttgccttgacaaatccaccggctattcccctacaaaagttggctcaagttttaggg
aaatttaattcaaaaattagagttcgtacgggacttaaagttgatgcaatctctcatcgg
agtgacttagttgatttagtgactaaagatggaatatatcatgaactattatctttacgt
ttgttttcacaaattatggaagcaggacgttttgcccaaagtcaggccgagcagttaaag
ataccgaccttattattttgtggagaagaagaccaaatttgttcaccgttagcgattcgt
tcctttgctgaaaatgctggtgctaatttggaattagttgaagttgctgagggctatcat
gcccttcatttagatactaaagcagatgctttcattgacaaaatgaaggctttcctgctt
gaataa

DBGET integrated database retrieval system