KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0955Help
Entry
llmg_0955         CDS       T00475                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00010  Glycolysis / Gluconeogenesis
llm00071  Fatty acid degradation
llm00350  Tyrosine metabolism
llm00625  Chloroalkane and chloroalkene degradation
llm00626  Naphthalene degradation
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01120  Microbial metabolism in diverse environments
llm01130  Biosynthesis of antibiotics
llm01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    llmg_0955
  Lipid metabolism
   00071 Fatty acid degradation
    llmg_0955
  Amino acid metabolism
   00350 Tyrosine metabolism
    llmg_0955
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    llmg_0955
   00626 Naphthalene degradation
    llmg_0955
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     llmg_0955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C ACP_syn_III TrkA_N
Motif
Other DBs
NCBI-ProteinID: CAL97547
UniProt: A2RJU2
Position
921340..922386
Genome map
AA seq 348 aa AA seqDB search
MRSAYFVEKNKMEVREFPKAQLVKETDAIIKIVRACVCGSDLWWFRGISERQPGPVGHEA
IGVIEEGGAGVKNFKAGDFVIVPFTHGCGHCPICLAGFEANCPNAKDGVNGGYQGEFYRA
INADGALVKIPGRPSDYSEEQLASLTTLADVMPTGFHAAKAADVHEGDTVVVFGDGAVGL
CAVISAKLLGAKRIIAMSRHEDRAALARDFGATDIIAERGAEAIQKIMAITNGYGADAAL
ECVGTKEAIESAFQAVRAGGRVGRVGVPHDVDYNEWIDSLFWKNIQLGGGVASVARWDKE
ILLEAVLSGEIDPGRVFTEEFTLDEIQKAYEAMDQRTAIKSLLIISEG
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcagcctattttgtcgaaaaaaataagatggaagttagagaatttcccaaagcg
caacttgtaaaagaaacagatgccattataaaaatcgttcgtgcctgcgtttgtggttct
gatttatggtggttccgtgggatttctgaacgtcagccaggtccagtaggtcatgaggct
attggtgtcattgaagaaggtggagcgggagttaaaaactttaaagcgggagattttgtc
attgttccctttactcatggttgtggacactgtccaatctgtttggcaggatttgaagct
aattgccccaatgctaaagatggagttaacgggggatatcaaggagaattctatcgagca
attaatgctgatggtgcacttgttaaaattccaggaagaccaagtgattattcagaagaa
cagctggcttcgttgacaactttagcggatgtcatgcccacaggttttcatgcggctaaa
gcagcagatgtccacgaaggcgacacagtagttgtctttggcgatggagcagtaggtctg
tgcgcagtgatttcggctaaacttttaggtgcaaaacggattattgcaatgagtcgccat
gaagatcgagcggcattggcgcgtgattttggggcaacagatatcattgctgagcgtggc
gcagaagcgattcaaaaaattatggccataaccaatggttatggtgctgatgctgcctta
gagtgtgtcggaacaaaagaagccattgaatctgctttccaagcagtaagagcgggagga
cgtgtaggtcgcgtgggagttcctcatgatgttgattacaatgaatggattgattctctt
ttttggaaaaatattcaacttggaggtggagtagcctctgtcgcacggtgggataaggaa
atcttacttgaagcagttttaagtggggagattgatccagggcgtgtctttacagaagaa
tttaccctagatgaaattcaaaaggcatatgaagcaatggatcaacggacagcaattaaa
tctttattgataatttcagaaggataa

DBGET integrated database retrieval system