KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_0992Help
Entry
llmg_0992         CDS       T00475                                 

Definition
nucleoside-diphosphate-sugar epimerase
Orthology
K00091  
dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Brite
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydrokaempferol 4-reductase
     llmg_0992
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
956790..957827
Genome map
AA seq 345 aa AA seqDB search
MTNTNKKLILVTGGSGYIAMFIMIALLKKGYRVRATLRMMSRQEEVKKMMKQGGIADFTD
LDFVQTDLTKEEGWSQAMTGVDSVIHVASPTPLQRPDADDLMVIMAVDGVKFVMRAAKEA
GVKRVVLTSASGAVLAGHKHHPEIFTEKDWTKLDAPINAYQRSKTMAELEFWKLAKSYGM
EGASVLPTAVMGPILGNDFSHSSASIKNMFEGKMPRLLNLAFDYVDVRDVADLHLLSLEK
EEAISQRFIATSGQNITYQEQAKFLKKEFGSKAKKVSTQVIPDFLVKILARFDKSLAMPA
TFLGQNTACSNEKSTRLLGWQPRSGEAAIIQTAQTMLDLAVIKVD
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatacaaataaaaaattaatactagtaactggtggttcgggttatattgctatg
ttcatcatgattgctttattaaaaaaaggctatcgagtacgggcgaccttgcggatgatg
tctagacaagaagaagtgaagaaaatgatgaagcaaggagggattgctgattttactgac
ctagactttgttcaaacggatttaactaaagaagaaggatggagtcaagcaatgactgga
gtggattctgtcatccacgtcgcttctccaacacccttgcaacgtcctgacgctgatgat
ttaatggtaataatggctgtagatggagtgaagtttgtgatgagagcagccaaggaagca
ggagttaaacgagtggttttgacctcagcatctggtgctgttttagcggggcataagcat
catccagaaatctttacagaaaaagactggacaaagcttgatgctccaattaatgcttat
caacgttctaaaacaatggctgaactggagttttggaaacttgccaaatcttatggtatg
gaaggagcctcagttctacctacggctgtcatgggaccgattcttgggaatgatttttca
cattctagcgcgtcaattaaaaatatgtttgaaggaaaaatgcctagacttttaaatttg
gcatttgactatgttgatgttcgtgatgttgctgatttacatttgttatctcttgaaaaa
gaagaagccattagtcagcgttttatcgcgacttcagggcaaaatattacttatcaggaa
caagcaaaatttttgaaaaaagaatttggttcaaaagccaagaaagtttctactcaagtt
attccagactttttagtgaagatcttggcacgttttgataaaagtttggcgatgccagcc
acatttttggggcaaaatacggcatgttcaaatgagaaatcaacaagacttttaggttgg
caaccccgttcgggagaagcagccattattcaaacagcgcaaacgatgttagatttggct
gtgattaaagttgattaa

DBGET integrated database retrieval system