KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1002Help
Entry
llmg_1002         CDS       T00475                                 

Gene name
xylA
Definition
XylA protein (EC:5.3.1.5)
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    llmg_1002 (xylA)
   00051 Fructose and mannose metabolism
    llmg_1002 (xylA)
Enzymes [BR:llm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     llmg_1002 (xylA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
968454..969149
Genome map
AA seq 231 aa AA seqDB search
MAYFNDIAPIKYEGTKTKNMFAFRHYNPEEVVAGKTMEEQLHFALAFWHTITMDGADPFG
SATMERPWDLEGGSELDRAHRRVDAFFEIAEKLGVKYYCFHDIDIAPTGNSLKEFYANLD
EITDHLLEKQKETGIKLLWNTANMFSNPRYMNGVSTSNRAEVFAYGAAQVKKGLELSKKL
DGENYVFWGGREGYESLLNTDMGLEMDHMAKFFHLAIDYAKWFCCKVLNKE
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
atggcttactttaacgacatcgcacctatcaaatacgaaggtacaaaaactaaaaacatg
tttgccttccgccattataacccagaagaagtggttgctgggaaaacaatggaagaacag
cttcatttcgcccttgctttttggcatacaattacgatggacggggctgacccatttggt
agtgccacaatggaacgtccttgggacttggaaggtggctctgaacttgaccgtgctcat
cgtcgagtagatgctttctttgaaattgccgaaaaattgggtgttaaatattattgtttc
catgatattgacatcgcgcctacaggaaattctttgaaagaattttatgcaaacttagat
gaaattactgaccatcttcttgaaaaacaaaaagaaacaggcattaaactcctctggaat
acggcaaatatgttctcaaacccacgttatatgaatggggtttcgacatcaaatcgtgct
gaagtttttgcttatggtgctgctcaagtcaaaaaaggacttgaactttctaaaaaactt
gatggtgaaaactatgtattctggggtggtcgtgaaggttacgaatcacttttgaacaca
gacatgggtcttgaaatggatcacatggcaaaattcttccatttggcgattgattatgca
aaatggttctgttgcaaagttttaaataaagaataa

DBGET integrated database retrieval system