KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1038Help
Entry
llmg_1038         CDS       T00475                                 

Gene name
trpC
Definition
(GenBank) TrpC protein
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
llm00400  Phenylalanine, tyrosine and tryptophan biosynthesis
llm01100  Metabolic pathways
llm01110  Biosynthesis of secondary metabolites
llm01130  Biosynthesis of antibiotics
llm01230  Biosynthesis of amino acids
Module
llm_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    llmg_1038 (trpC)
Enzymes [BR:llm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     llmg_1038 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Polysacc_deac_2 AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: CAL97630
UniProt: A2RK21
Position
999809..1000603
Genome map
AA seq 264 aa AA seqDB search
MNIKEGKFLETILAEKKQEIAQMPDENSKPIRQTYRLYDYLKKHSDQLQVIAEVKKASPS
LGDINLEVDIIAQAKNYEQAGAAMISVLTDPVFFKGNIEYLREISKNVQIPTLNKDFIID
KKQINRALNAGATVILLIVACFENDFEKLEELYNYAISLGLEVLVETHNKAELDRAHQLA
AKIIGVNNRNLKTFEVSLQNSTDLVPYFKEENVYISESGIFGKKEAQKVAENFNGILVGT
ALMQANNLTKSLTDLKIKRKNDEH
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaacataaaagaaggaaaattcttagaaacaattttagcagaaaaaaaacaagagata
gctcaaatgcctgacgaaaattccaaaccaattcgtcaaacttatagattatatgattac
ctaaaaaaacattctgatcaacttcaagtcattgccgaagtaaaaaaagcttcgccaagt
cttggagatatcaatctcgaagtagacattatcgcccaagccaaaaattatgaacaagct
ggggctgccatgatttccgttctaactgaccctgtattctttaaaggaaacattgaatac
ctccgtgaaatatctaagaatgttcaaattccaacacttaacaaagattttatcattgat
aaaaagcaaattaatcgagcactcaatgctggtgcaactgttattttattgattgtcgct
tgttttgaaaatgactttgaaaaattagaagaactctacaattatgcaatttcactagga
cttgaagttttagtcgaaacgcataataaggccgaactcgacagagcccatcaacttgct
gctaaaattattggggtcaataatcgtaatctaaagaccttcgaagtgagcttacaaaac
tcaacagatttggttccttattttaaagaagagaatgtttatatttctgaatcaggtatt
ttcggtaaaaaagaggcacaaaaagttgctgaaaatttcaatggaattttggttggaaca
gcactgatgcaagcaaataatctcacaaaatcactgacagatttaaaaatcaaaaggaaa
aatgatgaacattaa

DBGET integrated database retrieval system