KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1042Help
Entry
llmg_1042         CDS       T00475                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    llmg_1042 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    llmg_1042 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    llmg_1042 (trpA)
Enzymes [BR:llm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     llmg_1042 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1003463..1004224
Genome map
AA seq 253 aa AA seqDB search
MKTLQAKLSNKKNNFVPYIMAGDHERGLEGLNETIQLLEQAGSSAIEIGVPFSDPVADGP
VIEQAGLRALAKNVSLSKILDSLKSIETEVPLVIMTYFNPVYQFGIENFVAALESTAVKG
LIIPDLPKEHEAYIKPFITDKDICLVPLVSLTTPISRQKELVVDAEGFIYAVAINGVTGK
ENAYSNQLDHHLETLSKLTDIPVLTGFGISTLTDVERFNKVSAGVIVGSKIVRDLHENKE
SDVIKFIENAINF
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttacaagcaaaattgagcaataaaaaaaataattttgttccctatattatg
gcaggtgaccatgaaagaggattagaagggctcaatgaaaccattcaacttcttgaacaa
gccgggagttctgccattgaaattggtgtacccttctcagaccccgttgctgacggacca
gtaattgaacaagctggcttacgagccttagccaaaaatgtttcactatcaaagattctt
gacagcttaaaatcaattgaaacagaagttcctcttgtcattatgacttattttaatcct
gtctatcagtttggaattgaaaattttgttgcagctcttgagagtacagcagtaaaaggt
ctaattattcctgatttacctaaagaacatgaagcttacattaagccttttattactgat
aaggatatttgcttagtacctttggtgtcattaaccacaccaatttctcgtcagaaagaa
cttgtagtagatgccgaaggattcatttatgccgttgcgatcaatggagtaaccggaaaa
gaaaatgcttatagtaatcaacttgaccatcatttagaaacattgtctaaattaactgat
attcctgttttgacaggatttgggatttcaactttaacagatgttgaacgttttaataag
gtatcagcaggagtaatcgttggttcaaaaatagttagggatttacacgaaaacaaagaa
agtgatgttattaaatttattgaaaacgcaatcaatttttaa

DBGET integrated database retrieval system