KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1088Help
Entry
llmg_1088         CDS       T00475                                 

Gene name
gpo
Definition
gluthatione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    llmg_1088 (gpo)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    llmg_1088 (gpo)
Enzymes [BR:llm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     llmg_1088 (gpo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1046138..1046611
Genome map
AA seq 157 aa AA seqDB search
MNFYDFSAVKMNGETVSMSDYKGKVVIVVNTASKCGFTPQFEGLEKLYETYKDQGLEILG
FPCNQFANQDAGENTEINEFCQLNYGVTFTMFQKIKVNGKEAHPLYQFLKKEAKGALSGT
IKWNFTKFLIDRDGQVIERFAPKTEPEEMEEEIKKLL
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgaatttttatgattttagtgccgttaaaatgaacggtgaaactgtttcaatgtctgac
tacaaaggaaaagtcgtaatcgtagtcaatacagccagtaaatgtggttttactccacaa
tttgagggacttgaaaaattgtatgaaacatataaagaccaaggattagagattctagga
tttccttgtaatcagtttgctaatcaagatgctggtgaaaatacggaaattaatgaattc
tgtcagttgaattatggggttacattcaccatgtttcaaaaaattaaagtaaatggaaaa
gaagctcatccactttatcaatttttgaaaaaggaagccaaaggggcgcttagtggaact
attaaatggaatttcacaaagtttttaattgaccgagatggacaagtcattgaacgattt
gctcccaaaacggagcctgaagaaatggaagaagaaatcaaaaaattactttaa

DBGET integrated database retrieval system