KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1099Help
Entry
llmg_1099         CDS       T00475                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    llmg_1099 (glpK)
Enzymes [BR:llm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     llmg_1099 (glpK)
Exosome [BR:llm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   llmg_1099 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1058720..1060237)
Genome map
AA seq 505 aa AA seqDB search
MSEGLPLEATEKYIMAIDQGTTSSRAIIFDHDGKHVGTSQKEFTQYFPEAGWVEHDANEI
WNSVQSVIAGAFIESGIKPEQIAGIGITNQRETTVVWDKTTGLPIYHAIVWQSRQSASIA
DDLKNAGHAELFHKKTGLIIDSYFSATKIRWILDHVKGAQERAEKGELLFGTIDSWLVYK
LTDGKVHVTDYSNASRTMLFNINTLEWDQEILDLLNIPKIMLPKAVSNSEVYGLTKTYHF
FGSKVPIAGMAGDQQAALFGQMAFEPGMVKNTYGTGSFIVMNTGDKPQLSHNNLLTTIGY
GINGEINYALEGSVFVAGSSIQWLRDGLKIIDKASDSEAAALESKNEDEIYMVPAFVGLG
APYWDQDARGAIFGLTRGTTDKDLIKATLQGIAYQVRDILGAMGEDTGIEIPVLKVDGGA
TNNEYLMQFQADILNTSVQRAGDLETTSLGAAFLAGLAVGYWKDFDELKESAKEGKRFDV
QMEEERRNKLYSGWKKAVEATRSFE
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagggattaccattagaagccacagaaaaatatatcatggcaattgaccaagga
accacaagttcgcgcgcaattatttttgaccatgacggaaaacacgtcggaacaagccaa
aaagagttcactcaatattttccagaagcaggctgggttgagcatgatgccaatgaaatt
tggaattctgttcagtcagtcattgctggtgcttttattgaatcaggaattaaaccggaa
caaatcgccggaatagggattactaatcaacgcgaaacaaccgttgtctgggataaaaca
actggtctcccaatctatcacgccattgtctggcaatctcgtcagtcagcttcaattgct
gatgatttaaaaaatgccggtcatgctgaactttttcataaaaaaacaggattgattatc
gactcatatttctcagccacaaaaattcgctggatactagaccacgtcaaaggggcacaa
gaacgtgcagaaaaaggcgaacttctctttggaacgattgacagttggctcgtctacaaa
ttaactgacggaaaagttcacgtcactgactattcaaatgccagcaggaccatgcttttc
aatatcaatactttagaatgggaccaagaaattcttgaccttctcaacattccaaaaatc
atgctaccaaaagccgtctctaattctgaagtttacggcctaacaaagacttaccacttc
tttggctcaaaagttccaattgctggcatggcaggagaccaacaagctgcgctctttgga
caaatggcctttgaacctggcatggtcaaaaatacttatggcacaggttcatttatcgtc
atgaacacaggagataaacctcagctttcacacaacaatcttttgacaaccatcggttat
ggcattaatggtgaaatcaattatgcccttgaaggttctgtttttgttgctggttcttct
attcagtggttacgcgatggtttgaagattattgacaaagcaagcgactcagaagctgcc
gctcttgaatcaaaaaatgaagatgaaatctacatggttcctgctttcgtcggccttgga
gctccctattgggaccaagacgcccgtggtgcaatctttggactaactagaggaacaaca
gataaagacctcatcaaagcaactttacaaggaattgcctatcaggttcgtgatatttta
ggtgctatgggtgaagatacaggaatcgaaattcccgttcttaaagttgatggcggagca
acgaataatgaatatctcatgcaatttcaagcagatattttaaatacttccgttcaaaga
gctggagatttagaaacaacgtccctcggtgccgcattcctagccggtcttgccgttggt
tattggaaagattttgatgaacttaaagaatcagccaaagaaggaaaacgttttgacgtt
caaatggaagaggaacgccgcaataaactctattctggctggaagaaagccgtagaggca
acaagatcttttgaataa

DBGET integrated database retrieval system