KEGG   Lactococcus lactis subsp. cremoris MG1363: llmg_1113Help
Entry
llmg_1113         CDS       T00475                                 

Gene name
galU
Definition
UDP--glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
llm  Lactococcus lactis subsp. cremoris MG1363
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:llm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    llmg_1113 (galU)
   00052 Galactose metabolism
    llmg_1113 (galU)
   00500 Starch and sucrose metabolism
    llmg_1113 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    llmg_1113 (galU)
Enzymes [BR:llm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     llmg_1113 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1072316..1073257)
Genome map
AA seq 313 aa AA seqDB search
MKQTTIPNKARKVRKAVIPAAGLGTRFLPATKAIAKEMLPIVDKPTIQFIVEEALKSGIE
DILIVTGKAKRPIEDHFDSNIELEQNLLEKGKTELLKLVEETTDINLHFIRQSHPKGLGH
AVLQAKAFVGNEPFVVMLGDDLMNITGNETPLTKDLINDYEKTHASTIAVMKVPHEDVDK
YGVIDPNGEVSKGLYNVERFVEKPKVEEAPSDLAIIGRYLLTPEIFDVLETQVPGAGNEI
QLTDAIERLNKTQRVFAHEFTGKRYDVGDKLGFVETTIEYGLEHPQIGDNLKNYIIEKAK
ELSKDELKQNTKK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaaactactatacctaacaaagccagaaaagttcgtaaagctgttattcctgct
gctggtcttgggactcgctttttaccagcaactaaagccattgccaaagaaatgttgcca
attgttgataaacctactatccaattcatcgttgaagaagctttgaaatctggaatcgaa
gacattttgattgtaactggtaaagcaaaacgtccaattgaagaccattttgactcaaat
attgagcttgaacaaaatttacttgaaaaaggaaaaacagaattacttaaacttgttgaa
gaaacaacagatatcaatcttcattttatccgccaatctcatccaaaaggtttgggacac
gctgttcttcaagccaaagcttttgttggcaacgaaccttttgtagttatgcttggtgat
gatttgatgaatatcacaggcaatgaaactcctttgactaaagacttgattaatgattat
gaaaaaactcatgcttcaacaatcgctgtaatgaaagtgcctcatgaagatgttgacaaa
tacggagtaatcgaccctaatggcgaagtttctaaaggtctttacaatgttgaacgtttc
gttgaaaaaccaaaagttgaggaagctccttcagaccttgcaattatcggtcgttacctc
ttgactccagaaatttttgatgttttagaaacacaagtacctggtgctggaaatgaaatt
caattaactgatgcgattgaacgtttgaataaaacacaacgtgtctttgctcatgaattt
actggaaaacgttatgatgttggtgataaacttggttttgtggaaacaacaatcgagtat
ggtttagaacatccacaaatcggcgacaatttgaaaaattatatcatcgaaaaagctaaa
gaactttctaaagatgaactaaaacaaaatacaaaaaaataa

DBGET integrated database retrieval system